Recombinant Human FLT-3 Ligand Protein

Cat. No.: rp156013
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P49771
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp156013-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
199,90US$
50μg
rp156013-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
399,90US$
100μg
rp156013-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
639,90US$
1mg
rp156013-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His-Tag,≥95%(SDS-PAGE) Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Protein Function:
FLT3L, also known as flt3 ligand, is a small molecule that acts as a growth factor that increases the number of immune cells by activating the hematopoietic progenitors. In vivo, FLT3L also induces the mobilization of the hematopoietic progenitors and stem cells. This may help the system to kill cancer cells. Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3L controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 -positive classical DCs and their CD103 -positive tissue counterparts. 

Specifications

Product Name
Recombinant Human FLT-3 Ligand Protein
Sinónimos
FL | FLG3L | Flt3 ligand | Flt-3 Ligand | Flt3L | FLT3LG | fms-related tyrosine kinase 3 ligand | SL cytokine | FL | FLG3L | Flt3 ligand | Flt-3 Ligand | Flt3L | FLT3LG | fms-related tyrosine kinase 3 ligand | SL cytokine
Grado
Carrier Free, His Tag
Especificaciones y pureza
Carrier Free, His-Tag, ≥95%(SDS-PAGE)
Bioactividad
Testing in progress
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
27-181 aa
Secuencia
MGSSHHHHHHSSGLVPRGSHMTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA
Etiqueta proteínica
N-His
Número de adhesión
Peso molecular previsto
19.9 kDa
SDS-PAGE
15.1 kDa, under reducing conditions; 15.2 & 32.1 & 48.9 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human FLT-3 Ligand Protein (rp156013) - SDS-PAGE
2 μg/lane of Recombinant Human FLT-3 Ligand Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.9 kDa under reducing conditions and 19.5 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F1230182Certificate of AnalysisDec 12, 2025 rp156013
ZJ25F1230183Certificate of AnalysisDec 12, 2025 rp156013
ZJ25F1230184Certificate of AnalysisDec 12, 2025 rp156013
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.