Recombinant Human Frizzled-1 Protein

Cat. No.: rp166452
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
Q9UP38
Protein Tag
C-hFc & His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its binding ability in a functional ELISA. In a 100 µL reaction mixture containing biotinylated rmWnt-5a at 100 ng/mL and rhFrizzled-1/Fc Chimera dilutions at 0.1-8,000 ng/mL, the concentration of rhFrizzled-1/Fc Chimera that produces 50% of the optimal binding response is found to be approximately 20-80 ng/mL. Optimal concentrations should be determined by each laboratory for each application.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp166452-10μg
5
139,90US$
50μg
rp166452-50μg
4
409,90US$
100μg
rp166452-100μg
2
659,90US$
1mg
rp166452-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.299,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,Fc tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,Fc tag,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Function
Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Activated by Wnt3A, Wnt3, Wnt1 and to a lesser extent Wnt2, but not by Wnt4, Wnt5A, Wnt5B, Wnt6, Wnt7A or Wnt7B.

Specifications

Product Name
Recombinant Human Frizzled-1 Protein
Sinónimos
DKFZp564G072 | FLJ95923 | frizzled family receptor 1 | frizzled homolog 1 | frizzled, Drosophila, homolog of, 1 | Frizzled1 | Frizzled-1 | fz-1 | FZD1 | fzE1 | hFz1 | seven transmembrane spanning receptor | Wnt receptor | DKFZp564G072 | FLJ95923 | frizzle
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, Fc tag, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His-Tag, Fc tag, ≥95%(SDS-PAGE)
Bioactividad
Measured by its binding ability in a functional ELISA. In a 100 µL reaction mixture containing biotinylated rmWnt-5a at 100 ng/mL and rhFrizzled-1/Fc Chimera dilutions at 0.1-8, 000 ng/mL, the concentration of rhFrizzled-1/Fc Chimera that produces 50% of the optimal binding response is found to be approximately 20-80 ng/mL. Optimal concentrations should be determined by each laboratory for each application.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
HEK293
Aminoácidos
73-253 aa
Secuencia
QAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Etiqueta proteínica
C-hFc & His
Número de adhesión
Peso molecular previsto
47.6 kDa
SDS-PAGE
59-66 kDa, under reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human Frizzled-1 Protein (rp166452) - SDS-PAGE
2 μg/lane of Recombinant Human Frizzled-1 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing the band at 54 - 68 kDa

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0420649Certificate of AnalysisFeb 10, 2026 rp166452
ZJ25F0420650Certificate of AnalysisFeb 10, 2026 rp166452
ZJ25F0420651Certificate of AnalysisFeb 10, 2026 rp166452
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.