Recombinant Human GPR37 Protein

Cat. No.: rp192118
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE) See COA
Accession #
O15354
Protein Tag
C-10His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human GPR37 Protein (rp192118) at 1.0 μg/mL can bind Recombinant GPCR/GPR37 Antibody (Ab106130) with the EC50 of 2.9 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp192118-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
179,90US$
50μg
rp192118-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
539,90US$
100μg
rp192118-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
859,90US$
1mg
rp192118-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human GPR37 Protein
Sinónimos
EDNRBL | Endothelin B receptor-like protein 1 | ETBR-LP-1 | G protein-coupled receptor 37 (endothelin receptor type B-like) | GPR37 | hET(B)R-LP | PAELR | PAELRETBR-LP-1 | Parkin-associated endothelin receptor-like receptor | probable G-protein coupled re
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
GPR37 (G-protein coupled receptor 37), also called ETBR-LP-1 (endothelin B receptor-like protein 1) or PAELR (Parkin-associated endothelin receptor-like receptor), is a 587 aa, 7-transmembrane receptor for the neuroprotective and glioprotective factor pro
Bioactividad
Immobilized Recombinant Human GPR37 Protein (rp192118) at 1.0 μg/mL can bind Recombinant GPCR/GPR37 Antibody (Ab106130) with the EC50 of 2.9 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
1-265 aa
Secuencia
MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVMHHHHHHHHHH
Número de adhesión
Peso molecular previsto
29.3 kDa
SDS-PAGE
31.3-53.3 kDa, under reducing conditions; 31.3-53.3 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at 2-8℃ short term (1-2 weeks). Store at -20℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant  Human GPR37 Protein (rp192118) - ELISA
Immobilized Recombinant  Human GPR37 Protein (rp192118) at 1.0 μg/mL can bind Recombinant GPCR/GPR37 Antibody (Ab106130) with the EC50 of 2.9 ng/mL.

Recombinant Human GPR37 Protein (rp192118) - SDS-PAGE
3 μg/lane of Recombinant Human GPR37 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 31.3-53.3 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Objetivos asociados (humanos)
GPR37 Tbio Prosaposin receptor GPR37 (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0521567Certificate of AnalysisMar 16, 2026 rp192118
ZJ25F0521568Certificate of AnalysisMar 16, 2026 rp192118
ZJ25F0521569Certificate of AnalysisMar 16, 2026 rp192118
ZJ25R0402356Certificate of AnalysisApr 18, 2025 rp192118
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.