Recombinant Human GTPase HRAS Protein, >95% (SDS-PAGE)

Cat. No.: rp170121

GRADE & PURITY Carrier Free, Azide Free, His Tag, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

P01112

Protein Tag

N-His

Expression system

E. coli

Descripción general

Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
HRas, also known as HRAS, belongs to the small GTPase superfamily, Ras family, and is widely expressed. It functions in signal transduction pathways. HRas can bind GTP and GDP, and they have intrinsic GTPase activity. It undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Defects in HRAS are the cause of faciocutaneoskeletal syndrome (FCSS). FCSS is a rare condition characterized by prenatally increased growth, postnatal growth deficiency, mental retardation, distinctive facial appearance, cardiovascular abnormalities, tumor predisposition, skin, and musculoskeletal abnormalities. Defects in HRAS also can cause congenital myopathy with excess of muscle spindles. HRAS deficiency may be a cause of susceptibility to Hurthle cell thyroid carcinoma. It has been shown that defects in HRAS can cause susceptibility to bladder cancer which is a malignancy originating in tissues of the urinary bladder. It often presents with multiple tumors appearing at different times and different sites in the bladder. Most bladder cancers are transitional cell carcinomas. They begin in cells that normally make up the inner lining of the bladder. Other types of bladder cancer include squamous cell carcinoma (cancer that begins in thin, flat cells) and adenocarcinoma (cancer that begins in cells that make and release mucus and other fluids). Bladder cancer is a complex disorder with both genetic and environmental influences. Defects in HRAS are the cause of oral squamous cell carcinoma.

Specifications

Product Name

Recombinant Human GTPase HRAS Protein, >95% (SDS-PAGE)

Sinónimos

c-H-ras | EC 3.6.5.2 | Ha-Ras | H-Ras-1 | p21ras | Transforming protein p21 | c-H-ras | CBAS/HAS | CHARAS1 | cHras | CTLO | GTPase HRas | H-Ras-1 | Ha-Ras | HAMSV | HaRas | HRAS | HRas1 | HRASIDX | KRAS | N-terminally processed | NRAS | p21ras | RASH_HUMA

Grado

Azide Free, Carrier Free, His Tag

Especificaciones y pureza

Carrier Free, Azide Free, His-Tag, ≥95%(SDS-PAGE)

Pureza

>95% (SDS-PAGE)

Sistema de expresión

E. coli

Aminoácidos

2-186 aa

Secuencia

MHHHHHHTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC

Etiqueta proteínica

N-His

Número de adhesión

P01112

Peso molecular previsto

21.8 kDa

SDS-PAGE

22.4 kDa, under reducing conditions

Tipo de molécula

Protein

Almacenamiento y envío

Forma

Lyophilized

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human GTPase HRAS Protein (rp170121)

Recombinant Human GTPase HRAS Protein (rp170121) - SDS-PAGE
3 μg/lane of Recombinant Human GTPase HRAS Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a band at 22.4 kDa under reducing conditions.