Recombinant Human HABP1/C1QBP Protein

Cat. No.: rp183572
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
Q07021
Protein Tag
C-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp183572-10μg
≥10
139,90US$
50μg
rp183572-50μg
10
219,90US$
100μg
rp183572-100μg
10
359,90US$
1mg
rp183572-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.599,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His Tag,PBS Only,≥95%(SDS-PAGE) Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Protein Function:
Hyaluronan binding protein 1 (HABP1), also known as C1qBP/C1qR and p32, is an ubiquitous acidic glycoprotein that functions both in spermatogenesis and as a receptor for proinflammatory molecules. HABP1 is synthesized with a 73 amino acid (aa) N-terminal propeptide. The 32 kDa mature human HABP1, which contains a MAM33-like sequence, shares 90% aa sequence identity with mouse and rat HABP1. HABP1 assembles into a doughnut shaped trimer with the negatively charged residues asymmetrically distributed on one face and lining the channel of the complex. HABP1 can be cleaved by cell surface MMP-14/MT1-MMP, a protease important in angiogenesis and tumor metastasis. Cell surface HABP1 binds a wide range of extracellular molecules including hyaluronan, vitronectin, complement component C1q, HMW kininogen, and bacterial and viral proteins. Within the cell, HABP1 binds to molecules containing the C1q globular domain, multiple isoforms of PKC, mitochondrial Hrk, the cytoplasmic tails of adrenergic and GABA-A receptors, the mRNA splicing factor ASF/SF2, and the CBF transcription factor. Apoptosis and direct phosphorylation by Erk1/2 induces HABP1 translocation to the nucleus.

Specifications

Product Name
Recombinant Human HABP1/C1QBP Protein
Sinónimos
C1QBP | complement component 1 Q subcomponent-binding protein, mitochondrial | complement component 1, q subcomponent binding protein | gC1qBP | GC1q-R protein | gC1qR | gC1Q-R | Glycoprotein gC1qBP | HABP1 | HABP1p33 | Hyaluronan-binding protein 1 | Mito
Grado
Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Carrier Free, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactividad
Testing in progress
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
75-282 aa
Secuencia
MMHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
24.6 kDa
SDS-PAGE
28.8 kDa, under reducing conditions; 28.8 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human HABP1/C1QBP Protein (rp183572) - SDS-PAGE
3 μg/lane of Recombinant Human HABP1/C1QBP Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 28.8 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0707728Certificate of AnalysisApr 17, 2026 rp183572
ZJ24F0707729Certificate of AnalysisApr 17, 2026 rp183572
ZJ24F0707730Certificate of AnalysisApr 17, 2026 rp183572
ZJ24R0600705Certificate of AnalysisJun 23, 2024 rp183572
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide → View PBS Only grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.