GRADE & PURITY Animal Free, Carrier Free, His Tag, PBS Only, ≥95%(SDS-PAGE)

Expression System

HEK293

Accession #

Q14508

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Descripción general

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
HE4 (also WFDC2; WAP Four-disulfide core domain protein 2) is a secreted, 25 kDa glycoprotein member of the Whey Acidic Protein family of molecules. It is expressed by a wide variety of epithelial cells, including respiratory epithelium, salivary gland mucous cells, breast duct epithelium, distal tubule renal epithelium, and epididymal epithelium. It is believed to play a role in innate defense, and/or function as a protease inhibitor (perhaps for neutrophil elastase). Ovarian epithelial tumors have an increased expression of HE4, leading to the suggestion that HE4 could represent a tumor marker for ovarian cancer. Mature human HE4 is 94 amino acids (aa) in length. It contains two WAP domains that likely mediate antiprotease and/or antimicrobial activity (aa 31‑73 and 74‑123). There are four potential splice variants. One shows a deletion of aa 27‑74, while three others show aa substitutions: 28 aa for aa 75‑124, 23 aa for aa 1‑74, and 10 aa for aa 71‑124. Over aa 31‑124, human HE4 shares 63% aa identity with an extended (144 amino acid) mouse form of mature HE4.

Specifications

Product Name

Recombinant Human HE4/WFDC2 Protein

Sinónimos

dJ461P17.6 | EDDM4 | Epididymal secretory protein E4 | epididymis-specific, whey-acidic protein type, four-disulfide core | HE4 | HE4MGC57529 | Major epididymis-specific protein E4 | Putative protease inhibitor WAP5 | WAP domain containing protein HE4-V4

Grado

Animal Free, Carrier Free, His Tag, PBS Only

Especificaciones y pureza

Animal Free, Carrier Free, His Tag, PBS Only, ≥95%(SDS-PAGE)

Bioactividad

Testing in progress

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

HEK293

Aminoácidos

1-124 aa

Secuencia

MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFHHHHHH

Etiqueta proteínica

C-His

Número de adhesión

Q14508

Peso molecular previsto

10.8 kDa

SDS-PAGE

19.3-25.3 kDa, under reducing conditions; 19.3-25.3 kDa, under non-reducing conditions

Tipo de molécula

Protein

Almacenamiento y envío

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human HE4/WFDC2 Protein (rp181298)

Recombinant Human HE4/WFDC2 Protein(rp181298) - SDS-PAGE
3 μg/lane of Recombinant Human HE4/WFDC2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 19.3-25.3 kDa.