Recombinant Human Histone H2AX Protein, >90% (SDS-PAGE)

Cat. No.: rp156659
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE)
Expression System
E. coli
Accession #
P16104
Protein Tag
N-His
Expression system
E. coli
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp156659-10μg
≥10
99,90US$
100μg
rp156659-100μg
10
499,90US$
1mg
rp156659-1mg
1
3.999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Azide Free,His-Tag,≥90%(SDS-PAGE) Azide Free,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.

Description:

Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation.


Specifications

Product Name
Recombinant Human Histone H2AX Protein, >90% (SDS-PAGE)
Sinónimos
AW228881 | H2A histone family member X | H2A.FX | H2A.X | H2a/x | H2AFX | H2AX | H2AX histone | H2AX_HUMAN | Hist5.2ax | Histone 2AX | Histone 2A | Histone H2A.X | Histone H2AX | RGD1566119
Grado
Azide Free, Carrier Free, His Tag
Especificaciones y pureza
Carrier Free, Azide Free, His-Tag, ≥90%(SDS-PAGE)
Pureza
>90% (SDS-PAGE)
Sistema de expresión
E. coli
Aminoácidos
1-130 aa
Secuencia
MGHHHHHHMSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAP
Etiqueta proteínica
N-His
Número de adhesión
Peso molecular previsto
14.8 kDa
SDS-PAGE
15.6 kDa, under reducing conditions; 15.6 kDa, under non-reducing condition
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human Histone H2AX Protein (rp156659) - SDS-PAGE
3 μg/lane of Recombinant Human Histone H2AX Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 15.6 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0303412Certificate of AnalysisJul 13, 2026 rp156659
ZJ24F0303413Certificate of AnalysisJul 13, 2026 rp156659
ZJ24F0303414Certificate of AnalysisJul 13, 2026 rp156659
ZJ24R0300327Certificate of AnalysisMar 08, 2024 rp156659
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View Azide Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.