Recombinant Human Histone H2B Protein, >95% (SDS-PAGE)

Cat. No.: rp156676
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P33778
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp156676-10μg
≥10
99,90US$
100μg
rp156676-100μg
≥10
399,90US$
1mg
rp156676-1mg
2
3.999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Azide Free,His-Tag,≥95%(SDS-PAGE) Azide Free,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Histones are a complex family of highly conserved basic proteins responsible for packaging chromosomal DNA into nucleosomes. Histone proteins exhibit two levels of diversity: 1. evolutionary diversity between species and 2. subtype diversity in a class(H1, H2A, H2B, H3 or H4) within a species. It has become more and more evident that histone modifications are key players in the regulation of chromatin states and dynamics as well as in gene expression. Therefore, histone modifications and the enzymatic machinery that set them are crucial regulators that can control cellular proliferation, differentiation, plasticity, and malignancy processes. However, extracellular histones are a double-edged sword because they also damage host tissue and may cause death. Histones bound to platelets, induced calcium influx, and recruited plasma adhesion proteins such as fibrinogen to induce platelet aggregation. Histone H2B proteins have been studied in a variety of species and are easily detected in most species. The reversible ubiquitylation of histone H2B has long been implicated in transcriptional activation and gene silencing. Phosphorylation of H2B serine 32 occurs in normal cycling and mitogen-stimulated cells. Notably, this phosphorylation is elevated in skin cancer cell lines and tissues compared with normal counterparts. HIST2H2BE is a member of the histone H2B family and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.

Specifications

Product Name
Recombinant Human Histone H2B Protein, >95% (SDS-PAGE)
Sinónimos
H2B/f | H2B-clustered histone 3 | Histone H2B.1 | Histone H2B.f | GL105 | H2B GL105 | H2B histone family member O | H2B histone family member S | H2B.1 | H2B.1 B | H2B.b | H2B.c | H2B.d | H2B.e | H2B.f | H2B.j | H2B.q | H2B/b | H2B/c | H2B/d | H2B/e | H2B
Grado
Azide Free, Carrier Free, His Tag
Especificaciones y pureza
Carrier Free, Azide Free, His-Tag, ≥95%(SDS-PAGE)
Pureza
>95% (SDS-PAGE)
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
1-126 aa
Secuencia
MGHHHHHHMPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Etiqueta proteínica
N-His
Número de adhesión
Peso molecular previsto
15.0 kDa
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human Histone H2B Protein (rp156676) - SDS-PAGE
3 μg/lane of Recombinant Human Histone H2B Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.0 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0202915Certificate of AnalysisJun 22, 2026 rp156676
ZJ24F0202916Certificate of AnalysisJun 22, 2026 rp156676
ZJ24F0202917Certificate of AnalysisJun 22, 2026 rp156676
ZJ24R0200288Certificate of AnalysisFeb 22, 2024 rp156676
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View Azide Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.