Recombinant Human HRV 3C Protein, >95% (SDS-PAGE)

Cat. No.: rp170396
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE) See COA
Expression System
E. coli
Accession #
P03303
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
2.5 Units/μg Unit definition:One unit is defined as the amount of enzyme needed to cleave 100 μg of fusion protein in 16 hours to 95% completion at 4°C in a buffer containing 50 mM Tris-HCl, 150 mM NaCl, pH 7.0.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
1KU
rp170396-1KU
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
259,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE),See COA ActiBioPure™,Azide Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
The HRV 3C Protease is a recombinant cysteine protease from human rhinovirus 3C (HRV 3C)expressed in and purified from Escherichia coli. HRV 3C Protease cleaves protein substrates with the recognition sequence Leu-Glu-Val-Leu-Phe-Gln-Gly-Pro between the Gln and Gly residues. The high specificity and affinity tags( 6xHis) of the protease make it an ideal choice for the removal of purification and detection tags on recombinant proteins and allows for flexibility in protease removal.
Source:
HRV 3C Protease is a recombinant cysteine protease from human rhinovirus 3C (HRV 3C) expressed in and purified from Escherichia coli.
HRV 3C enzyme digestion of His-GST-IL33 protein, according to the mass ratio (HRV 3C: target protein) 1:25 and 1:50 enzyme digestion, overnight at 4℃ enzyme digestion results are as follows: completely clean enzyme digestion

Specifications

Product Name
Recombinant Human HRV 3C Protein, >95% (SDS-PAGE)
Sinónimos
HRV-3C Protease | 3C Protease
Grado
ActiBioPure™, Azide Free, Bioactive, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE), See COA
Pureza
>95% (SDS-PAGE)
Bioactividad
2.5 Units/μg Unit definition:One unit is defined as the amount of enzyme needed to cleave 100 μg of fusion protein in 16 hours to 95% completion at 4°C in a buffer containing 50 mM Tris-HCl, 150 mM NaCl, pH 7.0.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
1538-1719 aa
Secuencia
MGSSHHHHHHSSGLVPRGSHMGPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLKKQYFVEKQ.
Etiqueta proteínica
N-His
Número de adhesión
Peso molecular previsto
22.3 kDa
SDS-PAGE
24.0 kDa, reducing conditions; 24.0 kDa, non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Liquid
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant HRV 3C Protease Protein (rp170396) - SDS-PAGE
3 μg/lane of Recombinant HRV 3C Protease Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 24.0 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0421091Certificate of AnalysisFeb 24, 2026 rp170396
ZJ23F1202038Certificate of AnalysisDec 12, 2023 rp170396
ZJ23R1200186Certificate of AnalysisDec 11, 2023 rp170396
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.