Recombinant Human HSP27 Protein

Cat. No.: rp169615

GRADE & PURITY Carrier Free, His Tag, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

P04792

Protein Tag

C-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Descripción general

Heat shock proteins (HSPs) are a family of highly conserved stress response proteins. Heat shock proteins function primarily as molecular chaperones by facilitating the folding of other cellular proteins, preventing protein aggregation, or targeting improperly folded proteins to specific degradative pathways. HSPs are typically expressed at low levels under normal physiological conditions but are dramatically up-regulated in response to cellular stress. Elevated levels of HSPs have been observed in association with ischemia/reperfusion, cancer, and chronic heart failure. HSP27 is a member of the small heat shock protein family, which also includes HSP25 and the alpha-crystallins. HSP27 forms a large oligomer and the extent of phosphorylation plays a role in determining specific functions. HSP27 also functions as an anti-apoptotic molecule, regulating apoptosis through direct interaction with key components of the apoptotic pathway. HSP27 binds and sequesters cytochrome c released from the mitochondria in response to an apoptotic stimulus. This prevents the proper assembly of the apoptosome and subsequently, the activation of procaspase-9 and procaspase-3.

Specifications

Product Name

Recombinant Human HSP27 Protein

Sinónimos

28 kDa heat shock protein | DKFZp586P1322 | Estrogen-regulated 24 kDa protein | Heat shock 27 kDa protein | heat shock 27kD protein 1 | heat shock 27kDa protein 1 | heat shock protein beta-1 | HMN2B | HS.76067 | HSP25 | HSP27 | HSP27HSP 27 | HSP28CMT2F |

Grado

Carrier Free, His Tag

Especificaciones y pureza

Carrier Free, His-Tag, ≥95%(SDS-PAGE)

Bioactividad

Testing in progress

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

E. coli

Aminoácidos

1-205 aa

Secuencia

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAKHHHHHH

Etiqueta proteínica

C-His

Número de adhesión

P04792

Peso molecular previsto

23.6 kDa

SDS-PAGE

26.9 kDa, under reducing conditions

Tipo de molécula

Protein

Almacenamiento y envío

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human HSP27 Protein (rp169615)

Recombinant Human HSP27 Protein (rp169615) - SDS-PAGE
2 μg/lane of Recombinant Human HSP27 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 26.9 kDa.