Recombinant Human IGF-I/IGF-1 Protein

Cat. No.: rp156332
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE) See COA
Accession #
P05019
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is typically 28.6 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp156332-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
28,90US$
50μg
rp156332-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
79,90US$
100μg
rp156332-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
99,90US$
1mg
rp156332-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
303,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥90%(SDS-PAGE),See COA ActiBioPure™,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IGF-I/IGF-1 Protein
Sinónimos
IBP1 | IGF1 | IGF-1 | IGF1A | IGFI | IGF-I | IGF-IA | IGF-IB | insulin-like growth factor 1 (somatomedin C) | insulin-like growth factor 1 | insulin-like growth factor I | insulin-like growth factor IA | insulin-like growth factor IB | Mechano growth fact
Grado
ActiBioPure™, Bioactive, Carrier Free, High Performance, PBS Only
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥90%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
Insulin-like growth factor 1 (IGF-1 or IGF-I), also known as somatomedin C, is the dominant effector of growth hormone and is structurally homologous to proinsulin. Human IGF-1 is synthesized as two precursor isoforms with N- and alternate Cterminal prop
Bioactividad
Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is typically 28.6 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
49-118 aa
Secuencia
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Número de adhesión
Peso molecular previsto
7.7 kDa
SDS-PAGE
10.2 & 13.8 kDa, under reducing conditions; 10.4 & 13.8 & 20.9 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human IGF-I/IGF-1 Protein (rp156332) - Bioactivity
Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is typically 28.6 ng/mL.

Recombinant Human IGF-I/IGF-1 Protein (rp156332) - SDS-PAGE
3 μg/lane of Recombinant Human IGF-I/IGF-1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.2 & 13.8 kDa under reducing conditions and 10.4 & 13.8 & 20.9 kDa under non-reducing conditions.
IGF-I/IGF-1 can form oligomers under certain conditions (PMID: 11551198).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0724545Certificate of AnalysisJun 16, 2026 rp156332
ZJ25F0724546Certificate of AnalysisJun 16, 2026 rp156332
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.