Recombinant Human IL-15 Protein, >97% (SDS-PAGE)

Cat. No.: rp147404
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥97%(SDS-PAGE)
Expression System
E.coli
Accession #
P40933
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.01 EU/μg
Bioactivity
1、The ED₅₀ as determined by the dose-dependent stimulation of the proliferation of CTLL-2 cells was found to be ≤ 0.5 ng/ml, corresponding to a specific activity of ≥ 2 x 10⁶ units/mg. 2、Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED₅₀ for this effect is 0.38 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
50μg
rp147404-50μg
1
599,90US$
100μg
rp147404-100μg
1
939,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,PBS Only,≥97%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity

>97% SDS-PAGE.


Function

Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

Specifications

Product Name
Recombinant Human IL-15 Protein, >97% (SDS-PAGE)
Sinónimos
IL15 | IL-15 | IL-15MGC9721 | interleukin 15 | interleukin-15 | IL-15
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, PBS Only, ≥97%(SDS-PAGE)
Pureza
>97% (SDS-PAGE)
Bioactividad
1、The ED₅₀ as determined by the dose-dependent stimulation of the proliferation of CTLL-2 cells was found to be ≤ 0.5 ng/ml, corresponding to a specific activity of ≥ 2 x 10⁶ units/mg. 2、Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED₅₀ for this effect is 0.38 ng/mL.
Concentración de endotoxinas
<0.01 EU/μg
Sistema de expresión
E.coli
Especie
Human
Aminoácidos
49-162 aa
Secuencia
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Etiqueta proteínica
No tag
Número de adhesión
Peso molecular previsto
12.9 kDa
SDS-PAGE
10.8 kDa, under reducing conditions; 10.8 kDa, under non-reducing conditions.
Nota
This product is about to be discontinued. The replacement product is rp156000
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitution Before use this product, please read the direction below carefully. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
For long term storage, the product should be stored ≤-20℃. Please avoid repeated freeze-thaw cycles after reconstitution. 12 months from date of receipt, -20 to -70℃ as supplied. 1 month, 2 to 8℃ under sterile conditions after reconstitution. 3 months, -2
Imágenes

Recombinant Human IL-15 Protein (rp147404) - Protein Bioactivity
Recombinant Human IL-15 stimulates cell proliferation of the CTLL-2 mouse cytotoxic T cell line. The ED₅₀ for this effect is typically less than 0.5 ng/mL.

Recombinant Human IL-15 Protein (rp147404) - SDS-PAGE
3 μg/lane of Recombinant Human IL-15 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.8 kDa.

Recombinant Human IL-15 Protein (rp147404) - Protein Bioactivity
Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED₅₀ for this effect is 0.38 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ23F0600491Certificate of AnalysisApr 07, 2026 rp147404
ZJ23F0600492Certificate of AnalysisApr 07, 2026 rp147404
ZJ23F0600493Certificate of AnalysisJul 03, 2023 rp147404
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.