Recombinant Human IL-1ra/IL-1F3 Protein, >95% (SDS-PAGE)

Cat. No.: rp170405
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P18510
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp170405-10μg
≥10
99,90US$
50μg
rp170405-50μg
10
319,90US$
100μg
rp170405-100μg
5
499,90US$
1mg
rp170405-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.199,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Azide Free,PBS Only,≥95%(SDS-PAGE) Azide Free,Carrier Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining.

Description:

IL-1ra was originally isolated from the urine of patients with monocytic leukemia and has also been purified from adherent monocytes. The naturally occurring, fully glycosylated form has an apparent molecular weight of about 25,000 Daltons. The protein shows 26% amino acid homology to IL-1 beta and 19% homology to IL-1 alpha. It will compete with either factor for receptor binding, but does not interact with either one. Human IL-1ra will bind to both types of IL-1 receptor (I and II) on human cells, but reportedly will not block binding to the type II receptor on murine pre-B cell lines. The recombinant, non-glycosylated form of IL-1ra blocks binding of IL-1 to its receptor equally as well as the naturally-occurring, glycosylated form. The IL-1ra has been shown to block the inflammatory responses induced by IL-1 both in vitro and in vivo. Currently, pre-clinical and clinical studies are underway to test possible therapeutic applications for IL-1ra in the treatment of sepsis, rheumatoid arthritis and chronic myelogenous leukemia.

Specifications

Product Name
Recombinant Human IL-1ra/IL-1F3 Protein, >95% (SDS-PAGE)
Sinónimos
DIRA | ICIL-1ra | IL1F3 | IL-1F3 | IL1ra | IL-1ra | IL-1ra3 | IL1RN | IL-1RN | interleukin 1 receptor antagonist | IRAP | MVCD4
Grado
Azide Free, Carrier Free, PBS Only
Especificaciones y pureza
Carrier Free, Azide Free, PBS Only, ≥95%(SDS-PAGE)
Pureza
>95% (SDS-PAGE)
Bioactividad
Testing in progress
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
26-177 aa
Secuencia
RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Etiqueta proteínica
No tag
Número de adhesión
Peso molecular previsto
17.1 kDa
SDS-PAGE
15.9 kDa, under reducing conditions; 15.9 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human IL-1ra/IL-1F3 Protein (rp170405) - SDS-PAGE
3 μg/lane of Recombinant Human IL-1ra/IL-1F3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 15.9 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0404841Certificate of AnalysisDec 16, 2025 rp170405
ZJ24F0404842Certificate of AnalysisDec 16, 2025 rp170405
ZJ24F0404843Certificate of AnalysisDec 16, 2025 rp170405
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.