Recombinant Human IL-36 alpha/IL-1F6 Protein

Cat. No.: rp147571
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
Q9UHA7
Protein Tag
C-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells. The ED50 for this effect is 4-24 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp147571-10μg
9
229,90US$
50μg
rp147571-50μg
5
669,90US$
100μg
rp147571-100μg
2
1.071,90US$
1mg
rp147571-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
4.499,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity
≥95% SDS-PAGE.
Endotoxin level
<1.0 EU/µg
Background:
Human IL-36 alpha, previously called IL-1F6 and FIL1 epsilon (family of IL-1 member epsilon), is a member of the IL-1 family which includes IL-1 beta, IL-1 alpha, IL-1ra, IL-18, and novel family members IL-36 Ra (IL-1F5), IL-36 beta (IL-1F8), IL-36 gamma (IL-1F9), IL-37 (IL-1F7) and IL‑38 (IL‑1F10). All family members show a 12 beta ‑strand, beta -trefoil configuration, and are believed to have arisen from a common ancestral gene. IL-36 alpha is an 18‑22 kDa, 158 amino acid (aa) intracellular and secreted protein that contains no signal sequence, no prosegment and no potential from N‑linked glycosylation sites. It can be released in response to LPS and the cell ATP‑induced activation of the P2X7 receptor. A 120 aa isoform missing aa 1‑38 has been reported. Human IL‑36 alpha (aa 6 ‑ 158) shares 57‑68% aa sequence identity with mouse, rabbit, equine and bovine IL‑36 alpha and 27‑57% aa sequence identity with other novel IL‑1 family members. IL‑36 alpha is mainly found in skin and lymphoid tissues, but also in fetal brain, trachea, stomach and intestine. It is expressed by monocytes, B and T cells. The receptor for IL‑36 alpha is a combination of IL‑1 Rrp2 (also called IL1RL2 or IL‑1 R6), mainly found in epithelia and keratinocytes, and the widely expressed IL‑1 RAcP. IL-36 alpha, beta, and gamma all activate NF-kappa B and MAPK pathways in an IL‑1 Rrp2 dependent manner, and induce production of inflammatory cytokines and chemokines such as CXCL8/IL-8. IL-36 alpha and other family members are overexpressed in psoriatic skin lesions, and transgenic overexpression of IL‑36 alpha in skin keratinocytes produces epidermal hyperplasia. IL-36 alpha is present in kidney tubule epithelia, and it is highly expressed in intubulointerstitial lesions in mouse models of chronic glomerulonephritis, lupus nephritis and diabetic nephritis.

Specifications

Product Name
Recombinant Human IL-36 alpha/IL-1F6 Protein
Sinónimos
FIL1 epsilon; FIL1; FIL1(EPSILON); FIL1E; IL-1 epsilon; IL1(EPSILON); IL1E; IL-1E; IL-1F6 (FIL-1-epsilon); IL1F6; IL-1F6; IL36 alpha; IL-36 alpha; IL36A; interleukin 1 family, member 6 (epsilon); interleukin 1, epsilon; Interleukin 36, Alpha; Interleukin-
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥95%(SDS-PAGE)
Bioactividad
Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells. The ED50 for this effect is 4-24 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Especie
Human
Aminoácidos
1-158 aa
Secuencia
MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLFHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
18 kDa
SDS-PAGE
16 kDa, under reducing conditions; 16 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human IL-36 alpha/IL-1F6 Protein (rp147571) - SDS-PAGE
3 μg/lane of Recombinant Human IL-36 alpha/IL-1F6 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 16 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1214970Certificate of AnalysisJul 13, 2026 rp147571
ZJ24F1214971Certificate of AnalysisJul 13, 2026 rp147571
ZJ24F1214972Certificate of AnalysisJul 13, 2026 rp147571
ZJ24F1114245Certificate of AnalysisJun 16, 2026 rp147571
ZJ24F1114246Certificate of AnalysisJun 16, 2026 rp147571
ZJ24F1114247Certificate of AnalysisJun 16, 2026 rp147571
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.