Recombinant Human IL-36Ra/IL-1F5 Protein

Cat. No.: rp169668

GRADE & PURITY Carrier Free, Azide Free, PBS Only, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

Q9UBH0

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Descripción general

Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
Human interleukin-36 receptor antagonist [IL-36Ra; previously IL-1F5 and also named FIL-1δ (delta), IL1HY1, IL1H3, and IL-1L1] is a member of the IL1 family of proteins. IL1 family members include IL-1 beta, IL-1 alpha, IL-1ra, IL18 and IL-1F5-F10. All family members show a 12 beta -strand, beta -trefoil configuration, and all family members are believed to have arisen from a common ancestral gene that underwent multiple duplications. The human IL36Ra/IL1F5 gene is in closest proximity to the gene for IL-1ra and is likely a relatively recent duplication of the IL-1ra gene. IL-36Ra/IL-1F5 is synthesized as a 155 amino acid (aa) protein that contains no signal sequence, no prosegment and no potential N-linked glycosylation site(s). Nevertheless, it appears to be secreted as a 17 kDa monomer. There is an alternate start site that potentially gives rise to an alternate splice form. The translated product, however, has a premature stop codon, resulting in a truncated 16 aa peptide. Human to mouse, full-length IL-1F5 has 90% aa identity. Within the family, IL-36Ra/IL-1F5 is 50% aa identical to IL-1ra, and 32%, 31%, 35%, 37%, 32% and 42% aa identical to IL-1 beta, IL-36 alpha /IL1F6, IL37/IL1F7, IL36 beta /IL1F8, IL36 gamma /IL1F9 and IL1F10, respectively. Cells reported to express IL36Ra/IL-1F5 include monocytes, B cells, dendritic cells/Langerhans cells, keratinocytes, and gastric fundus Parietal and Chief cells. The receptor for IL-36Ra/IL-1F5 has not been positively identified. Indirect evidence suggests it is IL-1 Rrp2 and/or IL-1 RAcP. In either case, activity association with receptor binding is also unclear. It was initially reported to be an antagonist of IL36 gamma /IL1F9 activity. This would be consistent with its hypothesized relationship to IL1ra. Studies, however, find IL-36Ra/IL-1F5 antagonist activity difficult to demonstrate.

Specifications

Product Name

Recombinant Human IL-36Ra/IL-1F5 Protein

Sinónimos

interleukin 1 family, member 5 (delta) | interleukin 1, delta | Interleukin 36 Receptor Antagonist | interleukin-1 family member 5 | Interleukin-1 receptor antagonist homolog 1 | Interleukin-1-like protein 1 | Interleukin-36 Receptor Antagonist | Interleu

Grado

Azide Free, Carrier Free, PBS Only

Especificaciones y pureza

Carrier Free, Azide Free, PBS Only, ≥95%(SDS-PAGE)

Bioactividad

Testing in progress

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

E. coli

Aminoácidos

2-155 aa

Secuencia

VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Etiqueta proteínica

No tag

Número de adhesión

Q9UBH0

Peso molecular previsto

16.8 kDa

SDS-PAGE

14.2 kDa,  under reducing conditions; 14.0 &14.3 kDa,  under reducing conditions

Tipo de molécula

Protein

Almacenamiento y envío

Forma

Lyophilized

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human IL-36Ra/IL-1F5 Protein (rp169668)

Recombinant Human IL-36Ra/IL-1F5 Protein (rp169668) - SDS-PAGE
3 μg/lane of Recombinant Human IL-36Ra/IL-1F5 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.2 kDa under reducing conditions and 14.0 & 14.3 kDa under non-reducing conditions.