Recombinant Human IL-4 Protein

Cat. No.: rp156008

GRADE & PURITY Carrier Free, Bioactive, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

P05112

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Recombinant Human IL‑4 Protein (rp156008) stimulates cell proliferation of TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.31 ng/mL.

Descripción general

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
Interleukin-4 (IL-4), also known as B cell-stimulatory factor-1, is a monomeric, approximately 13 kDa‑18 kDa Th2 cytokine that shows pleiotropic effects during immune responses. It is a glycosylated polypeptide that contains three intrachain disulfide bridges and adopts a bundled four alpha-helix structure. Human IL-4 is synthesized with a 24 aa signal sequence. Alternate splicing generates an isoform with a 16 aa internal deletion. Mature human IL-4 shares 55%, 39%, and 43% aa sequence identity with bovine, mouse, and rat IL-4, respectively. Human, mouse, and rat IL-4 are species-specific in their activities. IL-4 exerts its effects through two receptor complexes. The type I receptor, which is expressed on hematopoietic cells, is a heterodimer of the ligand binding IL-4 R alpha and the common gamma chain (a shared subunit of the receptors for IL-2, -7, -9, -15, and ‑21). The type II receptor on nonhematopoietic cells consists of IL-4 R alpha and IL‑13 R alpha 1. The type II receptor also transduces IL-13 mediated signals. IL-4 is primarily expressed by Th2-biased CD4+ T cells, mast cells, basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class switch to IgG4 and IgE in human B cells, acquisition of the Th2 phenotype by naïve CD4+ T cells, priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and activation of epithelial cells. IL-4 plays a dominant role in the development of allergic inflammation and asthma.
Due to its role in the differentiation of certain immune cell types, IL-4 is commonly used in combination with other growth factors to transform induced pluripotent stem cells into dendritic cells in high numbers. These dendritic cells can then be used for research or clinical applications to improve disease modeling, for screening and cell therapies. Study of IL-4 signaling has led to the development of monoclonal antibodies that can block the signaling pathway at various steps to mitigate the inflammatory response in certain autoimmune diseases. While IL-4 has the capacity to improve immune functions, treatments involving IL-4 have not been utilized due to the dangerous side effects that may result from IL-4 signaling in non-immune cells. Blockade of IL-4 signaling also has been studied as a therapeutic target to suppress inflammation in the tumor microenvironment. Use of IL-4 suppressors can also improve the efficacy of anti-tumor immunotherapies, as blocking IL-4 enhances the activity of tumor-specific T lymphocytes.

Specifications

Product Name

Recombinant Human IL-4 Protein

Sinónimos

IL4E12 | interleukin 4 | interleukin-4 | Lymphocyte stimulatory factor 1 | MGC79402 | pitrakinra | B cell growth factor 1 | BCDF | B-cell stimulatory factor 1 | BCGF1 | BCGF-1 | binetrakin | BSF1 | BSF-1 | IL4 | IL-4 | IL-4B_cell stimulatory factor 1

Grado

Bioactive, Carrier Free, High Performance, His Tag, PBS Only

Especificaciones y pureza

Carrier Free, Bioactive, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)

Bioactividad

Recombinant Human IL‑4 Protein (rp156008) stimulates cell proliferation of TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.31 ng/mL.

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

E. coli

Aminoácidos

25-153 aa

Secuencia

MGSSHHHHHHSSGLVPRGSHMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Etiqueta proteínica

N-His

Número de adhesión

P05112

Peso molecular previsto

17.2 kDa

SDS-PAGE

15.5 kDa, under reducing condition

Tipo de molécula

Protein

Almacenamiento y envío

Forma

Lyophilized

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Imágenes

Protein Bioactivity: Recombinant Human IL-4 Protein (rp156008)

Recombinant Human IL-4 Protein (rp156008) - Protein Bioactivity
Recombinant Human IL‑4 Protein (rp156008) stimulates cell proliferation of TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.31 ng/mL.

SDS-PAGE: Recombinant Human IL-4 Protein (rp156008)

Recombinant Human IL-4 Protein (rp156008) - SDS-PAGE
3 μg/lane of Recombinant Human IL-4 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 15.5 kDa under reducing conditions.