Recombinant Human IL-4R alpha Protein

Cat. No.: rp184044
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Accession #
P24394
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by its ability to inhibit IL-4 induced proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is typically 42.55 ng/mL in the presence of 20.0 ng/mL of Recombinant Human IL-4 Protein (rp147593).
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp184044-10μg
6
159,90US$
50μg
rp184044-50μg
3
459,90US$
100μg
rp184044-100μg
3
729,90US$
1mg
rp184044-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.

3.914,90US$

4.719,90US$
Guardar 805,00 US$ (17.06%)
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IL-4R alpha Protein
Sinónimos
CD124 | IL 4R alpha | IL-4 receptor subunit alpha | IL-4-binding protein | IL-4R subunit alpha | IL-4R-alpha | IL-4RA | IL4-BP | Il4r | IL4R nirs variant 1 | IL4RA | IL4RA_HUMAN | Interleukin 4 receptor | Interleukin 4 receptor alpha chain | sIL4Ralpha/pr
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)
Mecanismos bioquímicos y fisiológicos
Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production
Bioactividad
Measured by its ability to inhibit IL-4 induced proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is typically 42.55 ng/mL in the presence of 20.0 ng/mL of Recombinant Human IL-4 Protein (rp147593).
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
1-232 aa
Secuencia
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHHHHHHH
Número de adhesión
Peso molecular previsto
24.6 kDa
SDS-PAGE
38.1-53.0 kDa, under reducing conditions; 38.1-53.0 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human IL-4R alpha Protein (rp184044) - Protein Bioactivity
Measured by its ability to inhibit IL-4 induced proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is typically 42.55 ng/mL in the presence of 20.0 ng/mL of Recombinant Human IL-4 Protein (rp147593).

Recombinant Human IL-4R alpha Protein (rp184044) - SDS-PAGE
3 μg/lane of Recombinant Human IL-4R alpha Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 38.1-53.0 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1113643Certificate of AnalysisJun 15, 2026 rp184044
ZJ24F1113644Certificate of AnalysisJun 15, 2026 rp184044
ZJ24F1113645Certificate of AnalysisJun 15, 2026 rp184044
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.