Recombinant Human KGF/FGF-7 Protein, ＞90% (SDS-PAGE)

Cat. No.: rp156342

GRADE & PURITY Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, PBS Only, ≥90%(SDS-PAGE)

Expression System

E. coli

Accession #

P21781

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Measured in a cell proliferation assay using MCF-7. The ED50 for this effect is typically ＜2.0 ng/mL.

Descripción general

Purity: >90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
KGF (keratinocyte growth factor), also known as FGF-7 (fibroblast growth factor-7), is one of 22 known members of the mouse FGF family of secreted proteins that plays a key role in development, morphogenesis, angiogenesis, wound healing, and tumorigenesis (1-4). KGF expression is restricted to cells of mesenchymal origin. When secreted, it acts as a paracrine growth factor for nearby epithelial cells (1). KGF speeds wound healing by being dramatically upregulated in response to damage to skin or internal structures that results in high local concentrations of inflammatory mediators such as IL-1 and TNF-alpha. (2, 5). KGF promotes cell migration and invasion, and mediates melanocyte transfer to keratinocytes upon UVB radiation (6, 7). It has been used ectopically to avoid chemotherapy-induced oral mucositis in patients with hematological malignancies (1). Deletion of KGF affects kidney development, producing abnormally small ureteric buds and fewer nephrons (8). It also impedes hair follicle differentiation (9). The 194 amino acid (aa) KGF precursor contains a 31 aa signal sequence and, like all other FGFs, an ~120 aa beta -trefoil scaffold that includes receptor- and heparin-binding sites. KGF signals only through the IIIb splice form of the tyrosine kinase receptor, FGF R2 (FGF R2-IIIb/KGF R) (10). Receptor dimerization requires an octameric or larger heparin or heparin sulfate proteoglycan (11). FGF-10, also called KGF2, shares 51% aa identity and similar function to KGF, but shows more limited expression than KGF and uses an additional receptor, FGF R2-IIIc (12). Following receptor engagement, KGF is typically degraded, while FGF-10 is recycled (12). Mature human KGF, which is active across species, shares 98% aa sequence identity with bovine, equine, ovine and canine, 96% with mouse and porcine, and 92% with rat KGF, respectively.

Specifications

Product Name

Recombinant Human KGF/FGF-7 Protein, ＞90% (SDS-PAGE)

Sinónimos

FGF7 | Fibroblast growth factor 7 | FGF-7 | HBGF-7 | HBGF7 | Heparin-binding growth factor 7 | Keratinocyte growth factor | KGF | FGF-7 | HBGF-7 | Heparin-binding growth factor 7 | Keratinocyte growth factor

Grado

ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance, PBS Only

Especificaciones y pureza

Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, PBS Only, ≥90%(SDS-PAGE)

Pureza

＞90% (SDS-PAGE)

Bioactividad

Measured in a cell proliferation assay using MCF-7. The ED50 for this effect is typically ＜2.0 ng/mL.

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

E. coli

Especie

Human

Aminoácidos

32-194 aa

Secuencia

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Etiqueta proteínica

No tag

Número de adhesión

P21781

Peso molecular previsto

18.97 kDa

SDS-PAGE

18.4 kDa, reducing conditions; 17.4 kDa, non-reducing conditions

Tipo de molécula

Protein

Almacenamiento y envío

Forma

Lyophilized

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle.

Imágenes

Protein Bioactivity: Recombinant Human KGF/FGF-7 Protein (rp156342)

Recombinant Human KGF/FGF-7 Protein (rp156342) - Protein Bioactivity
Measured in a cell proliferation assay using MCF-7 cells. The ED₅₀ for this effect is typically < 2.0 ng/mL.

SDS-PAGE: Recombinant Human KGF/FGF-7 Protein (rp156342)

Recombinant Human KGF/FGF-7 Protein (rp156342) - SDS-PAGE
3 μg/lane of Recombinant Human KGF FGF-7 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 18.4 kDa under reducing conditions and 17.4 kDa under non-reducing conditions.