Recombinant Human LAG-3 Protein

Cat. No.: rp176292

GRADE & PURITY Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE)

Expression System

HEK293

Accession #

P18627

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

1. Immobilized Recombinant Human FGL1 Protein (rp146027) at 0.5 μg/mL can bind Recombinant Human LAG-3 Protein (rp176292) with the EC50 of 36.43 ng/mL. 2. Immobilized Recombinant Human LAG-3 Protein (rp176292) at 1.0 μg/mL can bind Relatlimab (anti-LAG-3/CD223) (Ab169321) with the EC50 of 41.53 ng/mL.

Descripción general

Protein Function：
LAG-3 (Lymphocyte activation gene-3), designated CD223, is a 70 kDa type I transmembrane protein that is a member of the immunoglobulin superfamily (IgSF). LAG-3 shares approximately 20% amino acid sequence homology with CD4, but has similar structure and binds to MHC class II with higher affinity, providing negative regulation of T cell receptor signaling. Human LAG-3 cDNA encodes 525 amino acids (aa) that include a 28 aa signal sequence, a 422 aa extracellular domain (ECD) with four Ig-like domains, a transmembrane region and a highly charged cytoplasmic region. Within the ECD, human LAG-3 shares sequence identity with mouse, rat, porcine, and bovine LAG-3. LAG-3 is expressed on activated CD4+ and CD8+ T cells, NK cells, and plasmacytoid dendritic cells (pDC), but not on resting T cells. LAG-3 on activated CD4+CD25+ Treg cells plays a role in their suppressive activity. LAG-3 limits the expansion of activated T cells and pDC in response to selected stimuli. A soluble 54 kDa form, sLAG-3, can be shed by metalloproteinases ADAM10 and TACE/ADAM17. While monomeric sLAG-3 itself may be inactive, shedding allows for normal T cell activation by removing negative regulation. Binding of a homodimerized sLAG-3/Ig fusion protein to MHC class II molecules induces maturation of immature DC, and secretion of cytokines such as IFN-gamma and TNF-alpha by type 1 cytotoxic CD8+ T cells and NK cells. sLAG-3/Ig has been used as a potential adjuvant to stimulate a cytotoxic anti-cancer immune response. In mice, deletion of LAG-3 and another negative regulator, PD-1, facilitates anti-cancer response but also blocks self-tolerance and increases susceptibility to autoimmune diseases. In humans, antibody-mediated down regulation of LAG-3 and PD-1 allows more effective control of chronic malaria, while in NOD (non obese diabetic) mice, deletion of LAG-3 alone accelerates diabetes. LAG-3 is an immune checkpoint protein that modulates T-cell activation and homeostasis and is a promising target for cancer immunotherapy.

Specifications

Product Name

Recombinant Human LAG-3 Protein

Sinónimos

CD223 | CD223 antigen | FDC protein | LAG-3 | LAG3 | Lag3 | LAG3_HUMAN | Lymphocyte activating 3 | Lymphocyte activation gene 3 | Lymphocyte activation gene 3 protein | Protein FDC | lymphocyte-activation gene 3 | Secreted lymphocyte activation gene 3 pro

Grado

ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only

Especificaciones y pureza

Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE)

Bioactividad

1. Immobilized Recombinant Human FGL1 Protein (rp146027) at 0.5 μg/mL can bind Recombinant Human LAG-3 Protein (rp176292) with the EC50 of 36.43 ng/mL. 2. Immobilized Recombinant Human LAG-3 Protein (rp176292) at 1.0 μg/mL can bind Relatlimab (anti-LAG-3/CD223) (Ab169321) with the EC50 of 41.53 ng/mL.

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

HEK293

Aminoácidos

1-450 aa

Secuencia

MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLHHHHHH

Etiqueta proteínica

C-His

Número de adhesión

P18627

Peso molecular previsto

47.0 kDa

SDS-PAGE

57.5 kDa, under reducing condition; 52.3 kDa, under non-reducing condition

Tipo de molécula

Protein

Almacenamiento y envío

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Imágenes

Binding Activity: Recombinant Human LAG-3 Protein (rp176292)

Recombinant Human LAG-3 Protein (rp176292) - Binding Activity
Immobilized Recombinant Human FGL1 Protein (rp146027) at 0.5 μg/mL can bind Recombinant Human LAG-3 Protein (rp176292) with the EC₅₀ of 36.43 ng/mL.

ELISA: Recombinant Human LAG-3 Protein (rp176292)

Recombinant Human LAG-3 Protein (rp176292) - ELISA
Immobilized Recombinant Human LAG-3 Protein (rp176292) at 1.0 μg/mL can bind Relatlimab (anti-LAG-3/CD223) (Ab169321) with the EC₅₀ of 41.53 ng/mL.

SDS-PAGE: Recombinant Human LAG-3 Protein (rp176292)

Recombinant Human LAG-3 Protein (rp176292) - SDS-PAGE
3 μg/lane of Recombinant Human LAG-3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 57.5 kDa under reducing conditions and 52.3 kDa under non-reducing conditions.