Recombinant Human LIF Protein

Cat. No.: rp221577
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE) See COA
Accession #
P15018
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is typically 0.33 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp221577-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
139,90US$
50μg
rp221577-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
379,90US$
100μg
rp221577-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
599,90US$
1mg
rp221577-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.511,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥90%(SDS-PAGE), See COA ActiBioPure™,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human LIF Protein
Sinónimos
CDF | D Factor | DIA | differentiation inhibitory activity | differentiation stimulating factor | Differentiation-stimulating factor | Emfilermin | HILDA | HILDAcholinergic differentiation factor | leukemia inhibitory factor (cholinergic differentiation f
Grado
ActiBioPure™, Bioactive, Carrier Free, High Performance, PBS Only
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥90%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
LIF (leukemia inhibitory factor) is a widely expressed, highly and variably glycosylated, 32‑62 kDa, monomeric, pleiotropic cytokine in the IL‑6 family of helical cytokines. The first exon encoding the signal sequence is alternately spliced, resulting in
Bioactividad
Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is typically 0.33 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
24-202 aa
Secuencia
GPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Número de adhesión
Peso molecular previsto
19.7 kDa
SDS-PAGE
18.5 kDa, under reducing conditions; 18.0 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human LIF Protein (rp221577) - Bioactivity
Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is typically 0.33 ng/mL.

Recombinant Human LIF Protein (rp221577) - SDS-PAGE
2 μg/lane of Recombinant human LIF protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.5 kDa under reducing conditions and 18.0 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.