Recombinant Human Lumican Protein

Cat. No.: rp181608
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P51884
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of A375 human melanoma cells. The ED50 for this effect is 1.01 μg/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp181608-10μg
≥10
119,90US$
50μg
rp181608-50μg
10
339,90US$
100μg
rp181608-100μg
10
519,90US$
1mg
rp181608-1mg
1
3.199,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Lumican is a 40 kDa member of the family of small leucine-rich repeat proteoglycans (SLRPs) and the class II subfamily. Human Lumican is synthesized as a 338 amino acid (aa) precursor that contains an 18 aa signal sequence and a 320 aa mature chain. The mature chain contains a negatively charged N-terminal domain containing sulfated tyrosine and disulfide bonds, 12 leucine-rich repeats (LRRs), four potential sites of N-linked glycosylation, and a carboxyl terminal domain containing two conserved cysteines. Mature human Lumican is 88%, 87%, and 70% aa identical to mature mouse, rat, and chick Lumican, respectively. SLRPs constitute an important fraction of noncollagenous extracellular matrix proteins (ECM) proteins. Lumican is expressed in a variety of tissues, including skin, artery, lung, cornea, kidney, bone, aorta, and articular cartilage. Lumican’s role in vivo has been found using Lumican null mice. These mice have functional deficits including corneal opacity as well as skin and tendon fragility associated with disorganized and loosely packed collagen fibers. The abnormal connective tissue phenotype seen in the Lumican null mice shows the importance of the role of Lumican in collagen fibrillogenesis. In addition to the control of collagen fibril assembly, Lumican has been shown to play a role in the regulation of cell proliferation, migration, and adhesion. Lumican’s over-expression has been reported in carcinoid tumor, breast, colorectal, neuroendocrine, uterine cervical and pancreatic cancers.

Specifications

Product Name
Recombinant Human Lumican Protein
Sinónimos
LDC | LUM | lumican proteoglycan | Lumican | SLRR2D | SLRR2DLDCKeratan sulfate proteoglycan lumican | Keratan sulfate proteoglycan lumican | KSPG lumican
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactividad
Measured by the ability of the immobilized protein to support the adhesion of A375 human melanoma cells. The ED50 for this effect is 1.01 μg/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
1-338 aa
Secuencia
MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLNHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
37.5 kDa
SDS-PAGE
44.2-54.7 kDa, under reducing conditions; 44.0-54.5 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human Lumican Protein (rp181608) - Protein Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of A375 human melanoma cells. The ED ₅₀ for this effect is 1.01 μg/mL.

Recombinant Human Lumican Protein (rp181608) - SDS-PAGE
3 μg/lane of Recombinant Human Lumican Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 44.2-54.7 kDa under reducing conditions and 44.0-54.5 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0707724Certificate of AnalysisFeb 24, 2026 rp181608
ZJ24F0707725Certificate of AnalysisFeb 24, 2026 rp181608
ZJ24F0707726Certificate of AnalysisFeb 24, 2026 rp181608
ZJ24F0707727Certificate of AnalysisFeb 24, 2026 rp181608
ZJ24R0600687Certificate of AnalysisJun 14, 2024 rp181608
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.