Recombinant Human MBL Protein

Cat. No.: rp181609
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE) See COA
Accession #
P11226
Protein Tag
C-His
Expression system
CHO
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp181609-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
119,90US$
50μg
rp181609-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
333,90US$
100μg
rp181609-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
497,90US$
1mg
rp181609-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.993,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,His Tag,PBS Only,≥90%(SDS-PAGE),See COA Animal Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human MBL Protein
Sinónimos
COLEC1 | COLEC1collectin-1 | Collectin-1 | HSMBPC | Mannan-binding protein | mannose-binding lectin (protein C) 2, soluble (opsonic defect) | mannose-binding lectin (protein C) 2, soluble | Mannose-binding lectin | mannose-binding protein C | MBL | MBL2 |
Grado
Animal Free, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, His Tag, PBS Only, ≥90%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
MBL (mannose-binding lectin) is primarily a liver-derived collagen-like serum protein, which binds sugar structures on micro-organisms and dying host cells and is one of the four known mediators that initiate activation of the complement system via the le
Bioactividad
Testing in progress
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
1-248 aa
Secuencia
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPIHHHHHH
Número de adhesión
Peso molecular previsto
24.8 kDa
SDS-PAGE
29.3 & 51.4 kDa, under reducing conditions; 51.4 & 89.8 & 124.6 & 210.6 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human MBL Protein (rp181609) - SDS-PAGE
2 μg/lane of Recombinant Human MBL Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 29.3 & 51.4 kDa under reducing conditions and 51.4 & 89.8 & 124.6 & 210.6 kDa under non-reducing conditions.
MBL is a multimeric lectin that recognizes a wide array of pathogens independently of specific antibody and initiates the lectin pathway of complement activation. The basic structural unit is a triple helix of MBL peptides, which aggregate into complement-fixing higher-order structures (tetramers, pentamers and hexamers) (PMID: 16105157).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0521143Certificate of AnalysisMar 17, 2026 rp181609
ZJ25F0521144Certificate of AnalysisMar 17, 2026 rp181609
ZJ25F0521145Certificate of AnalysisMar 17, 2026 rp181609
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.