Recombinant Human MMP-17 Protein

Cat. No.: rp166410
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE)
Expression System
HEK293
Accession #
Q9ULZ9-1
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its ability to cleave a fluorogenic peptide substrate Mca-PLAQAV-Dpa-RSSSR-NH2. The specific activity is >150 pmol/min/μg, as measured under the described condition.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp166410-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
499,90US$
50μg
rp166410-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
1.249,90US$
100μg
rp166410-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
1.749,90US$
1mg
rp166410-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
6.999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥90%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Endopeptidase that degrades various components of the extracellular matrix, such as fibrin. May be involved in the activation of membrane-bound precursors of growth factors or inflammatory mediators, such as tumor necrosis factor-alpha. May also be involved in tumoral process. Cleaves pro-TNF-alpha at the '74-Ala-|-Gln-75' site. Not obvious if able to proteolytically activate progelatinase A. Does not hydrolyze collagen types I, II, III, IV and V, gelatin, fibronectin, laminin, decorin nor alpha1-antitrypsin.

Specifications

Product Name
Recombinant Human MMP-17 Protein
Sinónimos
Matrix Metalloproteinase 17 | matrix metallopeptidase 17 (membrane-inserted) | matrix metalloproteinase 17 (membrane-inserted) | matrix metalloproteinase-17 | membrane-type matrix metalloproteinase 4 | membrane-type-4 matrix metalloproteinase | MMP17 | MM
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His-Tag, ≥90%(SDS-PAGE)
Bioactividad
Measured by its ability to cleave a fluorogenic peptide substrate Mca-PLAQAV-Dpa-RSSSR-NH2. The specific activity is >150 pmol/min/μg, as measured under the described condition.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
HEK293
Aminoácidos
39-531 aa (R125P, A182T)
Secuencia
APAPAPRAEDLSLGVEWLSRFGYLPPADPTTGQLQTQEELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQARRRPQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAGSTADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHFDDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESVSPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGDSQADGSHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
47 kDa
SDS-PAGE
56-65 kDa under reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0333122Certificate of AnalysisMar 18, 2026 rp166410
ZJ26F0333123Certificate of AnalysisMar 18, 2026 rp166410
ZJ26F0333124Certificate of AnalysisMar 18, 2026 rp166410
ZJ26F0333125Certificate of AnalysisMar 18, 2026 rp166410
ZJ26F0333126Certificate of AnalysisMar 18, 2026 rp166410
ZJ26F0333127Certificate of AnalysisMar 18, 2026 rp166410
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.