Recombinant Human MMP-9 Protein

Cat. No.: rp181214
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P14780
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1. Measured in a cell migration assay using A549 cells. 5.0 ng/mL of Recombinant Human MMP-9 can effectively induce A549 cells migration. 2. Immobilized Recombinant Human MMP-9 Protein (rp181214) at 1.0 μg/mL can bind Andecaliximab (anti-MMP9), the EC50 for this effect is 12.14 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp181214-10μg
≥10
219,90US$
50μg
rp181214-50μg
10
499,90US$
100μg
rp181214-100μg
10
799,90US$
1mg
rp181214-1mg
1
3.799,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE) Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Matrix metalloproteinases are a family of zinc and calcium dependent endopeptidases with the combined ability to degrade all the components of the extracellular matrix. MMP-9 (gelatinase B) can degrade a broad range of substrates including gelatin, collagen types IV and V, elastin and proteoglycan core protein. It is believed to act synergistically with interstitial collagenase (MMP-1) in the degradation of fibrillar collagens as it degrades their denatured gelatin forms. MMP-9 is produced by keratinocytes, monocytes, macrophages and PMN leukocytes. MMP-9 is present in most cases of inflammatory responses. Structurally, MMP-9 maybe be divided into five distinct domains: a pro-domain which is cleaved upon activation, a gelatin-binding domain consisting of three contiguous fibronectin type II units, a catalytic domain containing the zinc binding site, a proline-rich linker region, and a carboxyl terminal hemopexin-like domain.

Specifications

Product Name
Recombinant Human MMP-9 Protein
Sinónimos
matrix metalloproteinase-9 | MMP9 | MMP-9 | type V collagenase | 92 kDa gelatinase | 92 kDa type IV collagenase | CLG4B | EC 3.4.24 | EC 3.4.24.35 | Gelatinase B | GELB | macrophage gelatinase | MANDP2 | matrix metallopeptidase 9 | matrix metalloproteinas
Grado
Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactividad
1. Measured in a cell migration assay using A549 cells. 5.0 ng/mL of Recombinant Human MMP-9 can effectively induce A549 cells migration. 2. Immobilized Recombinant Human MMP-9 Protein (rp181214) at 1.0 μg/mL can bind Andecaliximab (anti-MMP9), the EC50 for this effect is 12.14 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
1-707 aa
Secuencia
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPEDHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
77.2 kDa
SDS-PAGE
81.8-106.3 kDa, under reducing condition.
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human MMP-9 Protein (rp181214) - ELISA
Immobilized Recombinant Human MMP-9 Protein (rp181214) at 1.0 μg/mL can bind Andecaliximab (anti-MMP9), the EC50 for this effect is 12.14 ng/mL.

Recombinant Human MMP-9 Protein (rp181214) - SDS-PAGE
2 μg/lane of Recombinant Human MMP-9 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 81.8-106.3 kDa under reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0606592Certificate of AnalysisJun 07, 2024 rp181214
ZJ24F0606573Certificate of AnalysisJun 07, 2024 rp181214
ZJ24F0606572Certificate of AnalysisJun 07, 2024 rp181214
ZJ24F0606571Certificate of AnalysisJun 07, 2024 rp181214
ZJ24F0606570Certificate of AnalysisJun 07, 2024 rp181214
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.