Recombinant Human MUC-1 Protein, ≥95% (SDS-PAGE)

Cat. No.: rp148996
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P15941-11
Protein Tag
C-hFc & His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its ability to increase beta-catenin levels in the cytoplasm and nucleus of HCT116 human colon adenocarcinoma cells. 0.01-1 ng/mL of Recombinant Human MUC-1 can effectively increase beta-catenin levels.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp148996-10μg
≥10
179,90US$
50μg
rp148996-50μg
8
449,90US$
100μg
rp148996-100μg
3
719,90US$
1mg
rp148996-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,Fc tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,Fc tag,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity
≥95% (SDS-PAGE)
Endotoxin level
<0.1 EU/μg
Function
The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack. The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, SRC and NF-kappa-B pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Promotes tumor progression. Regulates TP53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of TP53 and represses TP53 activity.

Specifications

Product Name
Recombinant Human MUC-1 Protein, ≥95% (SDS-PAGE)
Sinónimos
ADMCKD | ADMCKD1 | Breast carcinoma associated antigen DF3 | Breast carcinoma-associated antigen DF3 | CA 15-3 | CA15 3 | CA15 3 antigen | CA15-3 | CA15.3 | Cancer antigen 15-3 | Carcinoma associated mucin | Carcinoma-associated mucin | CD 227 | CD227 | D
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, Fc tag, High Performance, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, Fc tag, ≥95%(SDS-PAGE)
Pureza
≥95% (SDS-PAGE)
Bioactividad
Measured by its ability to increase beta-catenin levels in the cytoplasm and nucleus of HCT116 human colon adenocarcinoma cells. 0.01-1 ng/mL of Recombinant Human MUC-1 can effectively increase beta-catenin levels.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
HEK293
Especie
Human
Aminoácidos
1-167 aa
Secuencia
MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Etiqueta proteínica
C-hFc & His
Número de adhesión
Peso molecular previsto
45 kDa
SDS-PAGE
60-75 kDa, under reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human MUC-1 Protein (rp148996) - Protein Bioactivity
Measured by its ability to increase beta-catenin levels in the HCT116 human colon adenocarcinoma cells. 0.01 -1.0 ng/mL of Recombinant Human MUC-1 Protein (rp148996) can effectively increase beta-catenin levels.

Recombinant Human MUC-1 Protein (rp148996) - SDS-PAGE
3 μg/lane of Recombinant Human MUC-1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 55 - 65 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1214952Certificate of AnalysisJul 13, 2026 rp148996
ZJ24F1214953Certificate of AnalysisJul 13, 2026 rp148996
ZJ24F1214954Certificate of AnalysisJul 13, 2026 rp148996
ZJ24F0708025Certificate of AnalysisFeb 24, 2026 rp148996
ZJ24F0708026Certificate of AnalysisFeb 24, 2026 rp148996
ZJ24F0708027Certificate of AnalysisFeb 24, 2026 rp148996
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.