Recombinant Human NRG1-beta 1 Protein

Cat. No.: rp156330
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
Q02297-11
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using MCF‑7 human breast cancer cells. The ED50 for this effect is typically 0.73 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp156330-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
159,90US$
50μg
rp156330-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
359,90US$
100μg
rp156330-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
559,90US$
1mg
rp156330-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Protein Function:
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. Binds to ERBB4 (PubMed:10867024, PubMed:7902537). Binds to ERBB3 (PubMed:20682778). Acts as a ligand for integrins and binds (via EGF domain) to integrins ITGAV:ITGB3 or ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and ERRB3 are essential for NRG1-ERBB signaling. Induces the phosphorylation and activation of MAPK3/ERK1, MAPK1/ERK2 and AKT1 (PubMed:20682778). Ligand-dependent ERBB4 endocytosis is essential for the NRG1-mediated activation of these kinases in neurons (By similarity).

Specifications

Product Name
Recombinant Human NRG1-beta 1 Protein
Sinónimos
SMDF | Sensory and motor neuron-derived factor | ProNRG1 | Pro-NRG1 | pro-neuregulin-1, membrane-bound isoform | OTTHUMP00000230605 | OTTHUMP00000230603 | OTTHUMP00000225545 | OTTHUMP00000225477 | OTTHUMP00000225422 | OTTHUMP00000225421 | OTTHUMP000002254
Grado
ActiBioPure™, Bioactive, Carrier Free, High Performance, PBS Only
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥95%(SDS-PAGE)
Bioactividad
Measured in a cell proliferation assay using MCF‑7 human breast cancer cells. The ED50 for this effect is typically 0.73 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
121-191 aa
Secuencia
TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQK
Etiqueta proteínica
No tag
Número de adhesión
Peso molecular previsto
8.2 kDa
SDS-PAGE
11.1 kDa, under reducing conditions; 11.2 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human NRG1-beta 1 Protein (rp156330) - Protein Bioactivity
Measured in a cell proliferation assay using MCF‑7 human breast cancer cells. The ED₅₀ for this effect is typically 0.73 ng/mL.

Recombinant Human NRG1-beta 1 Protein (rp156330) - SDS-PAGE
3 μg/lane of Recombinant Human NRG1-beta 1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 11.1 kDa under reducing conditions and 11.2 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F1230187Certificate of AnalysisDec 12, 2025 rp156330
ZJ25F1230186Certificate of AnalysisDec 12, 2025 rp156330
ZJ25F1230185Certificate of AnalysisDec 12, 2025 rp156330
ZJ24R0800895Certificate of AnalysisAug 11, 2024 rp156330
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.