Recombinant Human NRG1-beta 2/HRG1-beta 2 Protein

Cat. No.: rp222178
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. ≥95%(SDS-PAGE) See COA
Accession #
Q02297-7
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells. The ED50 for this effect is 0.01 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp222178-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
69,90US$
50μg
rp222178-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
199,90US$
100μg
rp222178-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
299,90US$
1mg
rp222178-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
1.739,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,≥95%(SDS-PAGE),See COA ActiBioPure™,Bioactive,Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human NRG1-beta 2/HRG1-beta 2 Protein
Sinónimos
ARIA | GGF | GGF2 | HGL | HRG | HRG1 | HRGA | MST131 | MSTP131 | NDF | neuregulin 1 | Neuregulin1 beta 2 | Neuregulin-1 beta 2 | NRG1-IT2 | SMDF | ARIA | GGF | GGF2 | HGL | HRG | HRG1 | HRGA | MST131 | MSTP131 | NDF | neuregulin 1 | Neuregul
Grado
ActiBioPure™, Bioactive, Carrier Free
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, ≥95%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
Neuregulin 1 or NRG1 is one of four proteins in the neuregulin family that act on the EGFR family of receptors. This growth factor was originally identified as a 44-kD glycoprotein that interacts with the NEU / ERBB2 receptor tyrosine kinase to increase i
Bioactividad
Measured in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells. The ED50 for this effect is 0.01 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
177-237 aa
Secuencia
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ​
Número de adhesión
Peso molecular previsto
7.0 kDa
SDS-PAGE
7.0 kDa, under reducing conditions; 10.6 & 15.5 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human NRG1-beta 2/HRG1-beta 2 Protein (rp222178) - Protein Bioactivity 
Measured in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells. The ED50 for this effect is 0.01 ng/mL.
Recombinant Human NRG1-beta 2/HRG1-beta 2 Protein (rp222178) - SDS-PAGE 
3 μg/lane of Recombinant Human NRG1-beta 2/HRG1-beta 2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 7.0 kDa under reducing conditions and 10.6 & 15.5 kDa under non-reducing conditions. The NRG1-beta 2/HRG1-beta 2 is a class of EGF-like signaling molecules. Its domain is rich in cysteine residues and disulfide bonds, potentially facilitating disulfide bond formation (Uniprot ID: Q02297-7).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0231940Certificate of AnalysisFeb 06, 2026 rp222178
ZJ26F0231939Certificate of AnalysisFeb 06, 2026 rp222178
ZJ26F0231938Certificate of AnalysisFeb 06, 2026 rp222178
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.