Recombinant Human PF4V1 Protein

Cat. No.: rp232396
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥85%(SDS-PAGE) expressed in E. coli, See COA
Accession #
P10720
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp232396-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
139,90US$
50μg
rp232396-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
399,90US$
100μg
rp232396-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
629,90US$
1mg
rp232396-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
4.899,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His Tag,≥85%(SDS-PAGE),expressed in E. coli, See COA Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human PF4V1 Protein
Sinónimos
PF4V1 | Platelet Factor 4 Variant 1 | CXCL4L1 | CXCL4V1 | PF4alt | PF4var1 | SCYB4V1 | PF4-ALT | PF4A | C-X-C Motif Chemokine 4 | Platelet Factor 4 Variant | Platelet Factor 4 | Variant 1 (PF4-Like) | C-X-C Motif Chemokine 4 Variant
Grado
Carrier Free, His Tag
Especificaciones y pureza
Carrier Free, His Tag, ≥85%(SDS-PAGE), expressed in E. coli, See COA
Mecanismos bioquímicos y fisiológicos
Platelet Factor 4 Variant 1 (PF4V1) is a member of the intercrine alpha (chemokine CxC) family. PF4V1 is an inhibitor of angiogenesis and inhibitor of endothelial cell chemotaxis (in vitro). Post-translational: The N-terminal processed forms of platelet
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
31-104 aa
Secuencia
MHHHHHHFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES​
Número de adhesión
Peso molecular previsto
9.2 kDa
SDS-PAGE
11.3 kDa, under reducing conditions; 11.3 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
expressed in E. coli, See COA
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human PF4V1 Protein (rp232396) - SDS-PAGE 
3 μg/lane of Recombinant Human PF4V1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 11.3 kDa under reducing conditions and 11.3 kDa under non-reducing conditions. There are multiple pairs of disulfide bonds in the protein sequence. Disulfide bonds cause the protein to present as a polymer in a non-reducing conditions (Uniprot ID: P10720).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0434524Certificate of AnalysisApr 22, 2026 rp232396
ZJ26F0434525Certificate of AnalysisApr 22, 2026 rp232396
ZJ26F0434526Certificate of AnalysisApr 22, 2026 rp232396
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.