Recombinant Human PTGR1 Protein

Cat. No.: rp188505
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE) expressed in E. coli; See COA
Accession #
Q14914
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp188505-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
89,90US$
50μg
rp188505-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
269,90US$
100μg
rp188505-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
429,90US$
1mg
rp188505-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.599,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His Tag,≥90%(SDS-PAGE),expressed in E. coli; See COA Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human PTGR1 Protein
Sinónimos
LTB4DH | PTGR1 | Prostaglandin reductase 1 | PRG-1 | 15-oxoprostaglandin 13-reductase | Dithiolethione-inducible gene 1 protein | Leukotriene B4 12-hydroxydehydrogenase | NAD(P)H-dependent alkenal/one oxidoreductase | D3T-inducible gene 1 protein | DIG-1
Grado
Carrier Free, His Tag
Especificaciones y pureza
Carrier Free, His Tag, ≥90%(SDS-PAGE), expressed in E. coli; See COA
Mecanismos bioquímicos y fisiológicos
NAD(P)H-dependent oxidoreductase involved in metabolic inactivation of pro- and anti-inflammatory eicosanoids: prostaglandins (PG), leukotrienes (LT) and lipoxins (LX) (PubMed:25619643). Catalyzes with high efficiency the reduction of the 13, 14 double bon
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
2-329 aa
Secuencia
MHHHHHHVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA
Número de adhesión
Peso molecular previsto
36.7 kDa
SDS-PAGE
34.4 kDa, under reducing conditions; 34.2 & 87.6 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
expressed in E. coli; See COA
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human PTGR1 Protein (rp188505) - SDS-PAGE 
3 μg/lane of Recombinant Human PTGR1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 34.4 kDa under reducing conditions and 34.2 & 87.6 kDa under non-reducing conditions. PTGR1 can form Homodimer (Uniprot: Q14914).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0434705Certificate of AnalysisApr 27, 2026 rp188505
ZJ26F0434704Certificate of AnalysisApr 27, 2026 rp188505
ZJ26F0434703Certificate of AnalysisApr 27, 2026 rp188505
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.