Recombinant Human PTRHD1 Protein

Cat. No.: rp192178
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE) expressed in E. coli;See COA
Accession #
Q6GMV3
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp192178-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
89,90US$
50μg
rp192178-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
269,90US$
100μg
rp192178-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
429,90US$
1mg
rp192178-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.599,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His-Tag,≥90%(SDS-PAGE),expressed in E. coli;See COA Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human PTRHD1 Protein
Sinónimos
C2orf79 | Putative peptidyl-tRNA hydrolase PTRHD1 | Peptidyl-tRNA hydrolase domain-containing protein 1 | PTRHD1 | C2orf79 | Putative peptidyl-tRNA hydrolase PTRHD1 | Peptidyl-tRNA hydrolase domain-containing protein 1 | PTRHD1
Grado
Carrier Free, His Tag
Especificaciones y pureza
Carrier Free, His-Tag, ≥90%(SDS-PAGE), expressed in E. coli;See COA
Mecanismos bioquímicos y fisiológicos
Putative peptidyl-tRNA hydrolase PTRHD1 (PTRHD1) is a 140 amino acid protein, which is encoded by a gene located on human chromosome 2p23.3. Chromosome 2 is the second largest human chromosome; it consists of 237 million bases, encodes over 1, 400 genes an
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
2-140 aa
Secuencia
MHHHHHHHRGVGPAFRVVRKMAASGAEPQVLVQYLVLRKDLSQAPFSWPAGALVAQACHAATAALHTHRDHPHTAAYLQELGRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK
Número de adhesión
Peso molecular previsto
16.6 kDa
SDS-PAGE
15.7 kDa, under reducing conditions; 15.9 & 30.4 & 45.8 & 58.9 & 72.4 & 88.2 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
expressed in E. coli;See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human PTRHD1 Protein (rp192178) - SDS-PAGE
3 μg/lane of Recombinant Human PTRHD1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 15.7 kDa under reducing conditions and 15.9 & 30.4 & 45.8 & 58.9 & 72.4 & 88.2 kDa under non-reducing conditions. PTRHD1 can form polymers and two conformations through the β -folding of the N-terminal domain and intermolecular disulfide bonds (PMID: 27753167).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0131620Certificate of AnalysisJan 28, 2026 rp192178
ZJ26F0131621Certificate of AnalysisJan 28, 2026 rp192178
ZJ26F0131622Certificate of AnalysisJan 28, 2026 rp192178
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.