Recombinant Human RANK/TNFRSF11A Protein

Cat. No.: rp150852
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥95%(SDS-PAGE)
Accession #
Q9Y6Q6
Protein Tag
C-His & hFc
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its ability to inhibit TRANCE-induced osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 0.005‑0.035 µg/mL in the presence of 2 ng/mL of rmTRANCE.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp150852-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
39,90US$
50μg
rp150852-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
89,90US$
1mg
rp150852-1mg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
969,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,Fc tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,Fc tag,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human RANK/TNFRSF11A Protein
Sinónimos
ODFR | Osteoclast differentiation factor receptor | Receptor activator of NF-KB | CD265 antigen | CD265 | FEO | loss of heterozygosity, 18, chromosomal region 1 | ODFR | ODFROSTS | OFE | OPTB7 | Osteoclast differentiation factor receptor | PDB2 | RANK | L
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, Fc tag, High Performance, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His-Tag, Fc tag, ≥95%(SDS-PAGE)
Mecanismos bioquímicos y fisiológicos
Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Its interaction with EEIG1 promotes osteoclastogenesis via facilitating the transcription of NFATC1 and activation of PLCG2. Involved in the regulation of interaction
Bioactividad
Measured by its ability to inhibit TRANCE-induced osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 0.005‑0.035 µg/mL in the presence of 2 ng/mL of rmTRANCE.
Concentración de endotoxinas
<0.1 EU/μg
Especie
Human
Aminoácidos
29-213 aa
Secuencia
MQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Número de adhesión
Peso molecular previsto
48 kDa
SDS-PAGE
60 kDa, under reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Liquid
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human RANK/TNFRSF11A Protein (rp150852) - SDS-PAGE 
2 μg/lane of Recombinant Human RANK/TNFRSF11A Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 57 kDa under reducing conditions and 118 & 250 kDa under non-reducing conditions. The stability of the RANK protein's extracellular domain is conferred by intramolecular disulfide bonds formed by its cysteine residues. Prior to ligand binding, the Pre-Ligand Binding Assembly Domain (PLAD) mediates constitutive dimerization, a prerequisite for forming the active RANK-RANKL trimeric complex. This complex assembly triggers downstream signaling essential for bone metabolism and immune regulation, a well-defined mechanism in structural biology.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Objetivos asociados (humanos)
TNFRSF11A Tbio Tumor necrosis factor receptor superfamily member 11A (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.