Recombinant Human RBP4 Protein

Cat. No.: rp181310
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Accession #
P02753
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1. Immobilized Recombinant Human RBP4 Protein (rp181310) at 1.0 μg/mL can bind RBP4 Mouse mAb (Ab176170) with the EC50 of 20.2 ng/mL. 2. Immobilized Recombinant Human RBP4 Protein (rp181310) at 1.0 μg/mL can bind RBP4 Mouse mAb (Ab176167) with the EC50 of 73.4 ng/mL. 3. Immobilized Recombinant Human RBP4 Protein (rp181310) at 1.0 μg/mL can bind RBP4 Mouse mAb (Ab176165) with the EC50 of 61.7 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp181310-10μg
7
119,90US$
50μg
rp181310-50μg
4
333,90US$
100μg
rp181310-100μg
4
533,90US$
1mg
rp181310-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human RBP4 Protein
Sinónimos
interstitial | Plasma retinol-binding protein | RBP4 | retinol binding protein 4, plasma | RetinolBinding Protein 4 | retinol-binding protein 4, plasma
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE)
Mecanismos bioquímicos y fisiológicos
Retinol (also known as vitamin A) is unstable and insoluble in aqueous solutions. However, retinol becomes quite stable and soluble in plasma due to its tight interaction with retinol-binding protein 4 (RBP4), also known as plasma retinol-binding protein.
Bioactividad
1. Immobilized Recombinant Human RBP4 Protein (rp181310) at 1.0 μg/mL can bind RBP4 Mouse mAb (Ab176170) with the EC50 of 20.2 ng/mL. 2. Immobilized Recombinant Human RBP4 Protein (rp181310) at 1.0 μg/mL can bind RBP4 Mouse mAb (Ab176167) with the EC50 of 73.4 ng/mL. 3. Immobilized Recombinant Human RBP4 Protein (rp181310) at 1.0 μg/mL can bind RBP4 Mouse mAb (Ab176165) with the EC50 of 61.7 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
1-201 aa
Secuencia
MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLHHHHHH
Número de adhesión
Peso molecular previsto
21.9 kDa
SDS-PAGE
18.8-24.1 kDa, under reducing conditions; 17.6 & 38.8 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human RBP4 Protein (rp181310) - ELISA
Immobilized Recombinant Human RBP4 Protein (rp181310) at 1.0 μg/mL can bind RBP4 Mouse mAb (Ab176170) with the EC50 of 20.2 ng/mL.

Recombinant Human RBP4 Protein (rp181310) - ELISA
Immobilized Recombinant Human RBP4 Protein (rp181310) at 1.0 μg/mL can bind RBP4 Mouse mAb (Ab176167) with the EC50 of 73.4 ng/mL.

Recombinant Human RBP4 Protein (rp181310) - ELISA
Immobilized Recombinant Human RBP4 Protein (rp181310) at 1.0 μg/mL can bind RBP4 Mouse mAb (Ab176165) with the EC50 of 61.7 ng/mL.

Recombinant Human RBP4 Protein (rp181310) - SDS-PAGE
3 μg/lane of Recombinant Human RBP4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.8-24.1 kDa under reducing conditions and 17.6 & 38.8 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1013035Certificate of AnalysisJun 15, 2026 rp181310
ZJ24F1013036Certificate of AnalysisJun 15, 2026 rp181310
ZJ24F1013037Certificate of AnalysisJun 15, 2026 rp181310
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.