Recombinant Human S100A7 Protein

Cat. No.: rp183703

GRADE & PURITY Carrier Free, PBS Only, ≥95%(SDS-PAGE), See COA

Expression System

E. coli

Accession #

P31151

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Descripción general

Protein Function:
Protein S100-A7, also known as S100 calcium-binding protein A7, Psoriasin, S100A7, and PSOR1, is a secreted protein which belongs to theS-100 family. S100A7 was first isolated from skin involved by psoriasis, which can be induced in cultured squamous epithelial cells. S100A7 is expressed by both normal cultured and malignant keratinocytes and malignant breast epithelial cells within ductal carcinoma in situ, suggesting an association with abnormal pathways of differentiation. S100A7 plays a role in the pathogenesis of inflammatory skin disease, as a chemotactic factor for hematopoietic cells. It also plays a role in early stages of breast tumor progression in association with the development of the invasive phenotype.

Specifications

Product Name

Recombinant Human S100A7 Protein

Sinónimos

HID 5 | HID5 | HID-5 | protein S100-A7 | PSOR1 | psoriasin 1 | Psoriasin | S100 calcium binding protein A7 (psoriasin 1) | S100 calcium binding protein A7 | S100 calcium-binding protein A7 (psoriasin 1) | S100 calcium-binding protein A7 | S100A7 | S100A7c

Grado

Carrier Free, PBS Only

Especificaciones y pureza

Carrier Free, PBS Only, ≥95%(SDS-PAGE), See COA

Bioactividad

Testing in progress

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

E. coli

Aminoácidos

2-101 aa

Secuencia

SNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ​

Etiqueta proteínica

No tag

Número de adhesión

P31151

Peso molecular previsto

11.3 kDa

SDS-PAGE

12.4 kDa, under reducing conditions; 11.9 kDa, under non-reducing conditions

Tipo de molécula

Protein

Almacenamiento y envío

Concentración

See COA

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human S100A7 Protein (rp183703)

Recombinant Human S100A7 Protein (rp183703) - SDS-PAGE
2μg/lane of Recombinant Human S100A7 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 12.4 kDa under reducing conditions and 11.9 kDa under non-reducing conditions.