Recombinant Human SDF1 Protein, ＞95% SDS-PAGE

Cat. No.: rp151342

GRADE & PURITY Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

P48061

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Fully biologically active determined by the dose dependant migration of THP-1 cells. The optimum chemotaxis of SDF1 occurs at 10-60 ng/mL.

Descripción general

Purity

>95% SDS-PAGE.

Additional sequence information

Mature chain SDF1 alph

Function

Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation.

Post-translational

Processed forms SDF-1-beta(3-72) and SDF-1-alpha(3-67) are produced after secretion by proteolytic cleavage of isoforms Beta and Alpha, respectively. The N-terminal processing is probably achieved by DPP4. Isoform Alpha is first cleaved at the C-terminus to yield a SDF-1-alpha(1-67) intermediate before being processed at the N-terminus. The C-terminal processing of isoform Alpha is reduced by binding to heparin and, probably, cell surface proteoglycans.

Specifications

Product Name

Recombinant Human SDF1 Protein, ＞95% SDS-PAGE

Sinónimos

C-X-C motif chemokine 12 | hIRH | hSDF-1 | Intercrine reduced in hepatomas | IRH | PBSF | Pre-B cell growth-stimulating factor | SDF-1

Grado

ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag

Especificaciones y pureza

Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥95%(SDS-PAGE)

Pureza

＞95% SDS-PAGE

Bioactividad

Fully biologically active determined by the dose dependant migration of THP-1 cells. The optimum chemotaxis of SDF1 occurs at 10-60 ng/mL.

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

E. coli

Especie

Human

Aminoácidos

23-89 aa

Secuencia

PVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Etiqueta proteínica

N-His

Número de adhesión

P48061

Peso molecular previsto

9.1kDa

SDS-PAGE

9.9 kDa, under reducing conditions; 9.9 kDa, under non-reducing conditions.

Tipo de molécula

Protein

Almacenamiento y envío

Forma

Lyophilized

Reconstitución

Reconstitute in10 mM PBS (pH7.4) to a concentration of 0.1-1.0mg/mL. Do not vortex.

Condiciones de almacenamiento de almacenamiento

Store at -20°C

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Avoid repeated freeze/thaw cycles. Store at 2-8℃ for one month. Aliquot and store at -80℃ for 12 months.

Imágenes

Protein Bioactivity: Recombinant Human SDF1 Protein (rp151342)

Recombinant Human SDF1 Protein (rp151342) - Protein Bioactivity
Fully biologically active determined by the dose dependant migration of THP-1 cells. The optimum chemotaxis of SDF1 occurs at 10-60 ng/mL.

SDS-PAGE: Recombinant Human SDF1 Protein (rp151342)

Recombinant Human SDF1 Protein (rp151342) - SDS-PAGE
2.5 μg/lane of Recombinant Human SDF1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 9.9 kDa.