Recombinant Human Serpin A1/alpha-1-Antitrypsin Protein

Cat. No.: rp176707

GRADE & PURITY Animal Free, Carrier Free, His Tag, PBS Only, ≥95%(SDS-PAGE)

Expression System

HEK293

Accession #

P01009

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Descripción general

Protein Function:：
SerpinA1, also known as Alpha-1 antitrypsin (AAT), is a prototype member of the Serpin superfamily of the serine protease inhibitors. This serine protease inhibitor blocks the protease, neutrophil elastase. Alpha-1 antitrypsin is mainly produced in the liver and acts as an antiprotease. Its principal function is to inactivate neutrophil elastase, preventing tissue damage. SerpinA1 (alpha1-antitrypsin), an acute phase protein and the classical neutrophil elastase inhibitor, is localized within lipid rafts in primary human monocytes in vitro. Its association with monocytes is inhibited by cholesterol depleting/efflux-stimulating agents (nystatin, filipin, MbetaCD (methyl-beta-cyclodextrin) and oxidized low-density lipoprotein (oxLDL) and conversely, enhanced by free cholesterol. Furthermore, SerpinA1/monocyte association per se depletes lipid raft cholesterol as characterized by the activation of extracellular signal-regulated kinase 2, formation of cytosolic lipid droplets, and complete inhibition of oxLDL uptake by monocytes. Previous population studies have suggested that heterozygote status for the AAT gene (SerpinA1) is a risk factor for chronic rhinosinusitis with nasal polyposis (CRSwNP). Alpha-1 antitrypsin deficiency is a recently identified genetic disease that occurs almost as frequently as cystic fibrosis. It is caused by various mutations in the SerpinA1 gene, and has numerous clinical implications. Alpha-1 antitrypsin deficiency is an inherited disease affecting the lung and liver. In the liver, alpha-1 antitrypsin deficiency may manifest as benign neonatal hepatitis syndrome; a small percentage of adults develop liver fibrosis, with progression to cirrhosis and hepatocellular carcinoma. Its most important physiologic functions are the protection of pulmonary tissue from aggressive proteolytic enzymes and regulation of pulmonary immune processes.

Specifications

Product Name

Recombinant Human Serpin A1/alpha-1-Antitrypsin Protein

Sinónimos

A1A | A1AT | AATMGC23330 | alpha 1-Antitrypsin | alpha 1-Proteinase Inhibitor | Alpha-1 protease inhibitor | Alpha-1-antiproteinase | alpha-1-antitrypsin | antitrypsin), member 1 | member 1 | PIMGC9222 | serine (or cysteine) proteinase inhibitor, clade A

Grado

Animal Free, Carrier Free, His Tag, PBS Only

Especificaciones y pureza

Animal Free, Carrier Free, His Tag, PBS Only, ≥95%(SDS-PAGE)

Bioactividad

Testing in progress

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

HEK293

Aminoácidos

1-418 aa

Secuencia

MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITP1NLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQKHHHHHHHHHH

Etiqueta proteínica

C-His

Número de adhesión

P01009

Peso molecular previsto

45.6 kDa

SDS-PAGE

56.5 kDa, under reducing conditions; 56.5 kDa, under non-reducing conditions

Tipo de molécula

Protein

Almacenamiento y envío

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human Serpin A1/alpha-1-Antitrypsin Protein (rp176707)

Recombinant Human Serpin A1/alpha-1-Antitrypsin Protein (rp176707) - SDS-PAGE
3 μg/lane of Recombinant Human Serpin A1/alpha-1-Antitrypsin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 56.5 kDa.