Recombinant Human Siglec-2/CD22 Protein

Cat. No.: rp169575
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE)
Expression System
HEK293
Accession #
P20273
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human Siglec-2/CD22 Protein (rp169575) at 1.0 μg/mL can bind Inotuzumab (anti-CD22) (Ab176429) with the EC50 of 20.1 ng/mL.  Immobilized Recombinant Human Siglec-2/CD22 Protein (rp169575) at 1.0 μg/mL can bind bind Epratuzumab (anti-CD22) (Ab175532) with the EC50 of 207.0 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp169575-10μg
4
159,90US$
50μg
rp169575-50μg
2
399,90US$
100μg
rp169575-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
559,90US$
1mg
rp169575-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥90%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity: ≥90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Siglecs (sialic acid binding Ig-like lectins) are I-type (Ig-type) lectins belonging to the Ig superfamily. They are characterized by an N-terminal Ig-like V-type domain which mediates sialic acid binding, followed by varying numbers of Ig-like C2-type domains. Eleven human Siglecs have been cloned and characterized. They are sialoadhesin/CD169/Siglec-1, CD22/Siglec-2, CD33/Siglec-3, Myelin-Associated Glycoprotein (MAG/Siglec-4a) and the identified Siglecs 5 to 11. To date, no Siglec has been shown to recognize any cell surface ligand other than sialic acid, suggesting that interactions with glycans containing this carbohydrate are important in mediating the biological functions of Siglecs.
Human Siglec-2, also known as B-cell antigen CD22 or B-lymphocyte cell adhesion molecule (BL-CAM), is a B-cell restricted glycoprotein that is expressed in the cytoplasm of progenitor B and pre-B cells and on the surface of mature B cells. Two distinct human Siglec-2/CD22 cDNAs that arise from differential RNA processing of the same gene have been isolated. The predominant Siglec-2/CD22 beta encodes an 847 amino acid (aa) polypeptide with a hydrophobic signal peptide, an N-terminal Ig-like V-type domain, six Ig-like C2-type domains, a transmembrane region and a cytoplasmic tail with 4 immunoreceptor tyrosine-based inhibition motifs (ITIMs). The variant Siglec-2/CD22 alpha encodes a 647 aa polypeptide missing two Ig-like C2-type domains and has a truncated (23 aa) cytoplasmic tail. Siglec-2/CD22 is an adhesion molecule that preferentially binds alpha 2,6- linked sialic acid on the same (cis) or adjacent (trans) cells. Interaction of CD22 with trans ligands on opposing cells was found to be favored over the binding of ligands in cis. Besides its role as an adhesion molecule, Siglec-2/CD22 is a coreceptor that physically interacts with B-cell receptor (BCR) and is rapidly phosphorylated upon BCR ligation. It negatively regulates BCR signals by recruiting tyrosine phosphatase SHP-1 to its ITIMs. Phosphorylated Siglec-2/CD22 can also interact with other intracellular effector proteins such as Syk, PLC gamma, PI3 kinase and Grb-2, suggesting it may play a role in positive signaling. 

Specifications

Product Name
Recombinant Human Siglec-2/CD22 Protein
Sinónimos
B-cell receptor CD22 | BL-CAM | B-lymphocyte cell adhesion molecule | CD22 antigenMGC130020 | CD22 molecule | CD22 | sialic acid binding Ig-like lectin 2 | Sialic acid-binding Ig-like lectin 2 | Siglec2 | Siglec-2 | SIGLEC2FLJ22814 | T-cell surface antige
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥90%(SDS-PAGE)
Bioactividad
Immobilized Recombinant Human Siglec-2/CD22 Protein (rp169575) at 1.0 μg/mL can bind Inotuzumab (anti-CD22) (Ab176429) with the EC50 of 20.1 ng/mL.  Immobilized Recombinant Human Siglec-2/CD22 Protein (rp169575) at 1.0 μg/mL can bind bind Epratuzumab (anti-CD22) (Ab175532) with the EC50 of 207.0 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
1-687 aa
Secuencia
MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
75.8 kDa
SDS-PAGE
115.2 kDa, under reducing conditions; 106.3 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human Siglec-2/CD22 Protein (rp169575) - ELISA
Immobilized Recombinant Human Siglec-2/CD22 Protein (rp169575) at 1.0 μg/mL can bind Inotuzumab (anti-CD22) (Ab176429) with the EC50 of 20.1 ng/mL.

Recombinant Human Siglec-2/CD22 Protein (rp169575) - ELISA
Immobilized Recombinant Human Siglec-2/CD22 Protein (rp169575) at 1.0 μg/mL can bind bind Epratuzumab (anti-CD22) (Ab175532) with the EC50 of 207.0 ng/mL.

Recombinant Human Siglec-2/CD22 Protein (rp169575) - SDS-PAGE
3 μg/lane of Recombinant Human Siglec-2/CD22 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 115.2 kDa under reducing conditions and 106.3 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0606791Certificate of AnalysisJun 14, 2024 rp169575
ZJ24F0606790Certificate of AnalysisJun 14, 2024 rp169575
ZJ24R0500608Certificate of AnalysisJun 02, 2024 rp169575
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.