Recombinant Human Siglec-3/CD33 Protein

Cat. No.: rp169578
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P20138
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1. Measured by the ability of the immobilized protein to support the adhesion of human red blood cells. The ED50 for this effect is < 6 µg/mL. 2. Immobilized Recombinant Human Siglec-3/CD33 Protein (rp169578) at 1.0 μg/mL can bind Vadastuximab (anti-CD33) (Ab182778) with the EC50 of 10.59 ng/mL. 3. Immobilized Recombinant Human Siglec-3/CD33 Protein (rp169578) at 1.0 μg/mL can bind Gemtuzumab (anti-CD33) (Ab175859) with the EC50 of 36.93 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp169578-10μg
9
119,90US$
50μg
rp169578-50μg
4
339,90US$
100μg
rp169578-100μg
4
599,90US$
1mg
rp169578-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE) Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity:≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Siglecs (sialic acid binding Ig-like lectins) are I-type (Ig-type) lectins belonging to the Ig superfamily. They are characterized by an N-terminal Ig-like V-type domain which mediates sialic acid binding, followed by varying numbers of Ig-like C2-type domains. Eleven human Siglecs have been cloned and characterized. They are sialoadhesin/CD169/Siglec-1, CD22/Siglec-2, CD33/Siglec-3, Myelin-Associated Glycoprotein (MAG/Siglec-4a) and Siglecs 5 to 11. To date, no Siglec has been shown to recognized any cell surface ligand other than sialic acids, suggesting that interactions with glycans containing this carbohydrate are important in mediating the biological functions of Siglecs. Siglecs 5 to 11 share a high degree of sequence similarity with CD33/Siglec-3 both in their extracellular and intracellular regions. They are collectively referred to as CD33-related Siglecs. One remarkable feature of the CD33-related Siglecs is their differential expression pattern within the hematopoietic system. This fact, together with the presence of two conserved immunoreceptor tyrosine-based inhibition motifs (ITIMs) in their cytoplasmic tails, suggests that CD33-related Siglecs are involved in the regulation of cellular activation within the immune system. Human Siglec-3 is alternatively known as myeloid cell surface antigen CD33 and GP67. Human Siglec-3 cDNA encodes a 364 amino acid (aa) polypeptide with a hydrophobic signal peptide, an N-terminal Ig-like V-type domain, one Ig-like C2-type domains, a transmembrane region and a cytoplasmic tail. Siglec-3 expression is restricted to cells of myelomonocytic lineage. It binds sialic acid preferring alpha 2,3-linkage over alpha 2,6-linkage. Studies indicated that Siglec-3 recruits SHP-1 and SHP-2 to its ITIMs. When co-cross-linking with Fc gamma R1, Siglec3- inhibits tyrosine phosphorylation and calcium mobilization, suggesting Siglec-3 can mediate inhibitory signals.

Specifications

Product Name
Recombinant Human Siglec-3/CD33 Protein
Sinónimos
CD33 antigen (gp67) | CD33 antigen | CD33 molecule | CD33 | FLJ00391 | gp67 | myeloid cell surface antigen CD33 | p67 | sialic acid binding Ig-like lectin 3 | Sialic acid-binding Ig-like lectin 3 | Siglec3 | Siglec-3 | SIGLEC3gp67
Grado
Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactividad
1. Measured by the ability of the immobilized protein to support the adhesion of human red blood cells. The ED50 for this effect is < 6 µg/mL. 2. Immobilized Recombinant Human Siglec-3/CD33 Protein (rp169578) at 1.0 μg/mL can bind Vadastuximab (anti-CD33) (Ab182778) with the EC50 of 10.59 ng/mL. 3. Immobilized Recombinant Human Siglec-3/CD33 Protein (rp169578) at 1.0 μg/mL can bind Gemtuzumab (anti-CD33) (Ab175859) with the EC50 of 36.93 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
1-259 aa
Secuencia
MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
27.6 kDa
SDS-PAGE
38.5-55.1 kDa, under reducing conditions; 38.5-55.1 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human Siglec-3/CD33 Protein (rp169578) - Protein Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of human red blood cells. The ED50 for this effect is < 6 µg/mL.

Recombinant Human Siglec-3/CD33 Protein (rp169578) - ELISA
Immobilized Recombinant Human Siglec-3/CD33 Protein (rp169578) at 1.0 μg/mL can bind Gemtuzumab (anti-CD33) (Ab175859) with the EC ₅₀ of 36.93 ng/mL.

Recombinant Human Siglec-3/CD33 Protein (rp169578) - ELISA
Immobilized Recombinant Human Siglec-3/CD33 Protein (rp169578) at 1.0 μg/mL can bind Vadastuximab (anti-CD33) (Ab182778) with the EC ₅₀ of 10.59 ng/mL.

Recombinant Human Siglec-3/CD33 Protein (rp169578) - SDS-PAGE
3 μg/lane of Recombinant Human Siglec-3/CD33 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 38.5-55.1 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0606550Certificate of AnalysisJun 07, 2024 rp169578
ZJ24F0606549Certificate of AnalysisJun 07, 2024 rp169578
ZJ24F0606548Certificate of AnalysisJun 07, 2024 rp169578
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.