Recombinant Human SPARC Protein

Cat. No.: rp181565
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) expressed in HEK293; See COA
Accession #
P09486
Protein Tag
C-10His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp181565-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
49,90US$
50μg
rp181565-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
139,90US$
100μg
rp181565-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
229,90US$
1mg
rp181565-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
839,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,His Tag,≥95%(SDS-PAGE),expressed in HEK293; See COA Animal Free,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human SPARC Protein
Sinónimos
Osteonectin | ON | Basement-membrane protein 40 | BM-40 | SPARC | Secreted Protein acidic and Rich in Cysteine
Grado
Animal Free, Carrier Free, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, His Tag, ≥95%(SDS-PAGE), expressed in HEK293; See COA
Mecanismos bioquímicos y fisiológicos
SPARC, an acronym for “secreted protein, acidic and rich in cysteine”, is also known as osteonectin or BM-40 (1-5). It is the founding member of a family of secreted matricellular proteins with similar domain structure. The 286 amino acid (aa), 43 kDa pro
Bioactividad
Testing in progress
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
1-303 aa
Secuencia
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVIHHHHHHHHHH​
Número de adhesión
Peso molecular previsto
34.1 kDa
SDS-PAGE
36.6-47.0 kDa, under reducing conditions; 31.1-41.1 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
expressed in HEK293; See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human SPARC Protein (rp181565) - SDS-PAGE 
3 μg/lane of Recombinant Human SPARC Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 36.6-47.0 kDa under reducing conditions and 31.1-41.1 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0535796Certificate of AnalysisMay 29, 2026 rp181565
ZJ26F0535795Certificate of AnalysisMay 29, 2026 rp181565
ZJ26F0535794Certificate of AnalysisMay 29, 2026 rp181565
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Animal Free grade guide → View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.