Recombinant Human TL1A/TNFSF15 Protein

Cat. No.: rp170417
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥90%(SDS-PAGE)
Expression System
E. coli
Accession #
O95150
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by its ability to induce apoptosis of TF1 human erythroleukemic cells.The ED50 for this effect is typically 1.15 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp170417-10μg
7
129,90US$
50μg
rp170417-50μg
4
489,90US$
100μg
rp170417-100μg
4
729,90US$
1mg
rp170417-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.979,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free, Bioactive, High performance, ActiBioPure™, ≥90%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Protein Function:
TL1A, also known as TNFSF15, is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. It is specifically expressed in endothelial cells. TL1A also can be detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon. TL1A is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It mediates activation of NF-kappa-B. It also inhibits vascular endothelial growth and angiogenesis (in vitro). TL1A promotes activation of caspases and apoptosis. It is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. 

Specifications

Product Name
Recombinant Human TL1A/TNFSF15 Protein
Sinónimos
MGC129934 | MGC129935 | TL1A | TL1Vascular endothelial cell growth inhibitor | TNF superfamily ligand TL1A | TNFSF15 | tumor necrosis factor (ligand) superfamily, member 15 | tumor necrosis factor ligand superfamily member 15 | vascular endothelial growth
Grado
ActiBioPure™, Bioactive, Carrier Free, High Performance
Especificaciones y pureza
Carrier Free, Bioactive, High performance, ActiBioPure™, ≥90%(SDS-PAGE)
Bioactividad
Measured by its ability to induce apoptosis of TF1 human erythroleukemic cells.The ED50 for this effect is typically 1.15 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
72-251 aa
Secuencia
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL​
Etiqueta proteínica
No tag
Número de adhesión
Peso molecular previsto
20.4 kDa
SDS-PAGE
20.5 kDa, under reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human TL1A/TNFSF15 Protein (rp170417) - Protein Bioactivity
Measured by its ability to induce apoptosis of TF1 human erythroleukemic cells.The ED₅₀ for this effect is typically 1.15 ng/mL.

Recombinant Human TL1A/TNFSF15 Protein (rp170417) - SDS-PAGE
3 μg/lane of Recombinant Human TL1A/TNFSF15 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 20.5 kDa under reducing conditions.

Recombinant Human TL1A/TNFSF15 Protein (rp170417) - Protein Bioactivity
TF-1 cells were co-stimulated with 10 μg/mL CHX (C112766) and 200 ng/mL Recombinant Human TL1A/TNFSF15 Protein (rp170417) for 24 hours. Cells were then stained with Annexin V-FITC/PI Apoptosis Detection Kit (A266226) and analyzed by FACS.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.