Recombinant Human TNF-α Protein, >95% (SDS-PAGE)

Cat. No.: rp156007

GRADE & PURITY Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

P01375

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 20-100 pg/mL.

Descripción general

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
Tumor necrosis factor alpha (TNF-alpha), also known as cachectin and TNFSF2, is the prototypic ligand of the TNF superfamily. It is a pleiotropic molecule that plays a central role in inflammation, immune system development, apoptosis, and lipid metabolism. Human TNF-alpha consists of a 35 amino acid (aa) cytoplasmic domain, a 21 aa transmembrane segment, and a 177 aa extracellular domain (ECD). Within the ECD, human TNF-alpha shares 97% aa sequence identity with rhesus and 71%-92% with bovine, canine, cotton rat, equine, feline, mouse, porcine, and rat TNF-alpha. TNF-alpha is produced by a wide variety of immune, epithelial, endothelial, and tumor cells. TNF-alpha is assembled intracellularly to form a noncovalently linked homotrimer which is expressed on the cell surface. Cell surface TNF-alpha can induce the lysis of neighboring tumor cells and virus-infected cells, and it can generate its own downstream cell signaling following ligation by soluble TNFR I. Shedding of membrane-bound TNF-alpha by TACE/ADAM17 releases the bioactive cytokine, a 55 kDa soluble trimer of the TNF-alpha extracellular domain. TNF-alpha binds the ubiquitous 55-60 kDa TNF RI and the hematopoietic cell-restricted 80 kDa TNF RII, both of which are also expressed as homotrimers. Both type I and type II receptors bind TNF-alpha with comparable affinity, although only TNF RI contains a cytoplasmic death domain which triggers the activation of apoptosis. Soluble forms of both types of receptors are released and can neutralize the biological activity of TNF-alpha.

Specifications

Product Name

Recombinant Human TNF-α Protein, >95% (SDS-PAGE)

Sinónimos

Cachectin | TNF-a | TNF-alpha | Tumor necrosis factor ligand superfamily member 2 | APC1 | APC1 protein | Cachectin | DIF | Differentiation inducing factor | Macrophage cytotoxic factor | Tnf | TNF superfamily member 2 | TNF superfamily, member 2 | TNF, m

Grado

ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only

Especificaciones y pureza

Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)

Pureza

>95% (SDS-PAGE)

Bioactividad

Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 20-100 pg/mL.

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

E. coli

Aminoácidos

78-233 aa

Secuencia

MGSSHHHHHHSSGLVPRGSHMRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Etiqueta proteínica

N-His

Número de adhesión

P01375

Peso molecular previsto

19.5 kDa

SDS-PAGE

17.6 kDa, under reducing conditions；17.6 kDa, under non-reducing condition

Tipo de molécula

Protein

Almacenamiento y envío

Forma

Lyophilized

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Imágenes

Protein Bioactivity: Recombinant Human TNF-α Protein (rp156007)

Recombinant Human TNF-α Protein (rp156007) - Protein Bioactivity
Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED₅₀ for this effect is 20-100 pg/mL.

SDS-PAGE: Recombinant Human TNF-α Protein (rp156007)

Recombinant Human TNF-α Protein (rp156007) - SDS-PAGE
1.5 μg/lane of Recombinant Human TNF-α Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 17.6 kDa.