Recombinant Human Vitronectin Protein

Cat. No.: H751559
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Low Endotoxin ? Low-endotoxin grade — endotoxin reduced to low controlled levels. Use in sensitive biological work where high endotoxin would interfere. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE) Embryo cell culture grade,Sterile
Accession #
P04004
Protein Tag
No tag
Expression system
CHO
Endotoxin Concentration
<1.0 EU/mg
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 2-10 μg/mL. Optimal concentration depends on cell type as well as the application or research objectives.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
500μg
H751559-500μg
1
228,90US$
1mg
H751559-1mg
1
399,90US$
5×1mg
H751559-5×1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
1.571,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Low Endotoxin,High Performance,≥95%(SDS-PAGE),Embryo cell culture grade,Sterile ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,Low Endotoxin for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Vitronectin Protein
Sinónimos
Complement S Protein | Epibolin | S Protein | S-protein | Serum Spreading Factor | Serum-spreading factor | Somatomedin B | Somatomedin-B | V75 | Vitronectin | Vitronectin V10 subunit | Vitronectin V65 subunit | VN | VNT | VTN | VTNC_HUMAN
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, Low Endotoxin
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Low Endotoxin, High Performance, ≥95%(SDS-PAGE), Embryo cell culture grade, Sterile
Mecanismos bioquímicos y fisiológicos
Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. In
Bioactividad
Measured by the ability of the immobilized protein to support the adhesion of NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 2-10 μg/mL. Optimal concentration depends on cell type as well as the application or research objectives.
Concentración de endotoxinas
<1.0 EU/mg
Aminoácidos
20-478 aa
Secuencia
DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Número de adhesión
Peso molecular previsto
52.3 kDa
SDS-PAGE
52.3 kDa
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
Embryo cell culture grade,Sterile
Reconstitución
It is recommended to redissolve in sterile deionized water.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
36 months at -20°C to -80°C in lyophilized state. 6 months at -20°C to -80°C under sterile conditions after reconstitution. 7-10 days at 2°C to 8°C under sterile conditions after reconstitution. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human Vitronectin Protein (H751559) - Protein Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of NIH3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 2-10 μg/mL.

Recombinant Human Vitronectin Protein (H751559) - SDS-PAGE
2 μg/lane of Recombinant Human Vitronectin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 55 - 65 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

1 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0535388Certificate of AnalysisMay 15, 2026 H751559
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.