Recombinant Mouse CCL7/MARC Protein

Cat. No.: rp186590
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥90%(SDS-PAGE) See COA
Accession #
Q03366
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Determined by its ability to chemoattract human monocytes using a concentration range of 10.0-100.0 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp186590-10μg
5
177,90US$
50μg
rp186590-50μg
2
473,90US$
100μg
rp186590-100μg
3
755,90US$
1mg
rp186590-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
4.917,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥90%(SDS-PAGE), See COA ActiBioPure™,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Mouse MARC, a member of the beta  subfamily of chemokines, was initially identified as a transcript that is induced in a mouse mast cell line after Fc epsilon RI triggering by IgE plus antigen. Sequence comparisons suggest that MARC may be the mouse homologue of the human MCP-3 gene. Mouse MARC/MCP-3 expression has also been detected during murine experimental allergic encephalomyelitis in the spinal cord, and in LPS-stimulated murine WEHI -3 cells and Swiss 3T3 cells where MARC expression is glucocorticoid-attenuated. Except for one amino acid subsititution, mouse MARC is identical to mouse FIC, the product of a growth factor-activated gene. The mouse MARC cDNA encodes a 97 amino acid residue precursor protein with a 23 amino acid residue signal peptide that is cleaved to yield a 74 amino acid residue mature protein. Mouse CCR2, a mouse chemokine receptor, has been shown to bind JE/MCP-1 with high affinity and MARC/MCP-3 with lower affinity. The E. coli-expressed mouse MARC/MCP-3 produced at R&D Systems has been shown to be a monocyte and T-lymphocyte chemoattractant.

Specifications

Product Name
Recombinant Mouse CCL7/MARC Protein
Sinónimos
C-C motif chemokine 7 | CCL7 | chemokine (C-C motif) ligand 7 | FIC | MARC | MCP-3 | MCP3Monocyte chemotactic protein 3 | MCP-3Small-inducible cytokine A7 | MGC138465 | Monocyte chemoattractant protein 3 | NC28SCYA6 | SCYA7MGC138463 | small inducible cyto
Grado
ActiBioPure™, Bioactive, Carrier Free, High Performance
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥90%(SDS-PAGE), See COA
Bioactividad
Determined by its ability to chemoattract human monocytes using a concentration range of 10.0-100.0 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
24-97 aa
Secuencia
QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Número de adhesión
Peso molecular previsto
8.5 kDa
SDS-PAGE
12.2 kDa, under reducing conditions; 12.9 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Imágenes

Recombinant Mouse CCL7/MARC Protein (rp186590) - Bioactivity
Determined by its ability to chemoattract human monocytes using a concentration range of 10.0-100.0 ng/mL.

Recombinant Mouse CCL7/MARC Protein (rp186590) - SDS-PAGE
3 μg/lane of Recombinant Mouse CCL7/MARC Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 12.2 kDa under reducing conditions and 12.9 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0218261Certificate of AnalysisDec 15, 2025 rp186590
ZJ25F0218262Certificate of AnalysisDec 15, 2025 rp186590
ZJ25F0218263Certificate of AnalysisDec 15, 2025 rp186590
ZJ25F0218264Certificate of AnalysisDec 15, 2025 rp186590
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.