Recombinant Mouse CD14 Protein, >95%(SDS-PAGE)

Cat. No.: rp153710
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
Q4FJP7
Protein Tag
C-hFc & His
Expression system
HEK293
Endotoxin Concentration
<0.01 EU/μg
Bioactivity
Measured by its ability to enhance LPS-induced IL-6 secretion by mouse splenocytes. The ED50 for this effect is 0.4-2.4 µg/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
2μg
rp153710-2μg
≥10
121,90US$
10μg
rp153710-10μg
≥10
287,90US$
100μg
rp153710-100μg
2
452,90US$
1mg
rp153710-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
4.785,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,Fc tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,Fc tag,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity

>90% SDS-PAGE.


Additional sequence information

This product is for the mature full length protein. The signal peptide is not included. NP_033971


Function

Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules.


Post-translational

N- and O- glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.

Specifications

Product Name
Recombinant Mouse CD14 Protein, >95%(SDS-PAGE)
Sinónimos
CD 14 | CD_antigen=CD14 | CD14 | CD14 antigen | CD14 molecule | CD14_HUMAN | LPS-R | Mo2 | Monocyte differentiation antigen CD14 | Monocyte differentiation antigen CD14 urinary form | Monocyte differentiation antigen CD14, membrane-bound form | Myeloid ce
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, Fc tag, High Performance, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, Fc tag, ≥95%(SDS-PAGE)
Pureza
>95%(SDS-PAGE)
Bioactividad
Measured by its ability to enhance LPS-induced IL-6 secretion by mouse splenocytes. The ED50 for this effect is 0.4-2.4 µg/mL.
Concentración de endotoxinas
<0.01 EU/μg
Sistema de expresión
HEK293
Especie
Mouse
Aminoácidos
18-345 aa
Secuencia
APPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAPENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Etiqueta proteínica
C-Fc & His
Número de adhesión
Peso molecular previsto
62 kDa
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in water to a concentration of 0.1-1.0 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
12 months from date of receipt, -20 to -70 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, -20 to -70 ℃ under sterile conditions after reconstitution.
Imágenes

Recombinant Mouse CD14 Protein (rp153710) - Protein Bioactivity
Measured by its ability to enhance LPS-induced IL-6 secretion by mouse splenocytes. The ED₅₀ for this effect is 2.2 µg/mL.

Recombinant Mouse CD14 Protein (rp153710) - SDS-PAGE
2 μg/lane of Recombinant Mouse CD14 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 85.5 kDa under reducing conditions and 195.7 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1215055Certificate of AnalysisJul 15, 2026 rp153710
ZJ24F1215056Certificate of AnalysisJul 15, 2026 rp153710
ZJ24F1215057Certificate of AnalysisJul 15, 2026 rp153710
ZJ23F1101729Certificate of AnalysisApr 09, 2026 rp153710
ZJ23F1101730Certificate of AnalysisApr 09, 2026 rp153710
ZJ23F1101731Certificate of AnalysisApr 09, 2026 rp153710
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.