Recombinant Mouse Complement Component C3a Protein

Cat. No.: rp153647
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P01027
Protein Tag
C-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by its ability to enhance IL-6 secretion by human peripheral blood mononuclear cells (PBMC). The ED50 for this effect is typically 0.8-4 µg/mL
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp153647-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
129,90US$
50μg
rp153647-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
379,90US$
100μg
rp153647-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
599,90US$
1mg
rp153647-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity
≥95% (SDS-PAGE)
Endotoxin level
<1.0 EU/μg
Function
C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. Derived from proteolytic degradation of complement C3, C3a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.

Specifications

Product Name
Recombinant Mouse Complement Component C3a Protein
Sinónimos
Acylation stimulating protein cleavage product | AHUS5 | ARMD9 | ASP | C3 | C3 and PZP like alpha 2 macroglobulin domain containing protein 1 | C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1 | c3 complement | C3adesArg | CO3_HUMAN | Com
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥95%(SDS-PAGE)
Bioactividad
Measured by its ability to enhance IL-6 secretion by human peripheral blood mononuclear cells (PBMC). The ED50 for this effect is typically 0.8-4 µg/mL
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Especie
Mouse
Aminoácidos
671-748 aa
Secuencia
MSVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLARHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
10 kDa
SDS-PAGE
15 kDa, under reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0535498Certificate of AnalysisMay 21, 2026 rp153647
ZJ26F0535497Certificate of AnalysisMay 21, 2026 rp153647
ZJ26F0535496Certificate of AnalysisMay 21, 2026 rp153647
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.