Recombinant Mouse IL-1 beta Protein, >95%(SDS-PAGE)

Cat. No.: rp154118
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P10749
Protein Tag
C-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells.The ED₅₀ for this effect is typically 10-50 pg/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp154118-10μg
5
139,90US$
50μg
rp154118-50μg
2
511,90US$
100μg
rp154118-100μg
1
939,90US$
1mg
rp154118-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.329,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Background:

IL-1 is a name that designates two pleiotropic cytokines, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2), which are the products of distinct genes. IL-1 alpha and IL-1 beta are structurally related polypeptides that share approximately 17% amino acid (aa) identity in mouse. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1 alpha and IL-1 beta are regulated independently, they bind to the same receptor and exert identical biological effects. IL-1 RI binds directly to IL-1 alpha or IL-1 beta and then associates with IL-1 R accessory protein (IL-1 R3/IL-1 R AcP) to form a high-affinity receptor complex that is competent for signal transduction. IL-1 RII has high affinity for IL-1 beta but functions as a decoy receptor and negative regulator of IL-1 beta activity. IL-1ra functions as a competitive antagonist by preventing IL-1 alpha and IL-1 beta from interacting with IL-1 RI. The mouse IL-1 beta cDNA encodes a 269 aa precursor. A 117 aa propeptide is cleaved intracellularly by the cysteine protease IL-1 beta -converting enzyme (Caspase-1/ICE) to generate the active cytokine. The 17 kDa mature mouse IL-1 beta shares 90% aa sequence identity with cotton rat and rat and 65%-78% identity with canine, equine, feline, human, porcine, and rhesus IL-1 beta.


Post-translational modifications:

Activation of the IL1B precursor involves a CASP1-catalyzed proteolytic cleavage. Processing and secretion are temporarily associated.


Specifications

Product Name
Recombinant Mouse IL-1 beta Protein, >95%(SDS-PAGE)
Sinónimos
Catabolin | H1 | IFN beta inducing factor | IL 1 | IL 1 beta | IL-1 beta | IL1 | IL1 BETA | IL1B | Il-1b | IL1B_HUMAN | IL1F2 | Interleukin 1 beta | Interleukin 1 beta precursor | interleukin 1, beta | Interleukin-1 beta | OAF | Osteoclast activating fact
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥95%(SDS-PAGE)
Pureza
>95%(SDS-PAGE)
Bioactividad
Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells.The ED₅₀ for this effect is typically 10-50 pg/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Especie
Mouse
Aminoácidos
118-269 aa
Secuencia
MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSSHHHHHH
Etiqueta proteínica
C-His
Secuencia N-terminal
Met
Longitud de la proteína
Full length protein
Conjugación
Unconjugated
Número de adhesión
Fuente
Recombinant
Peso molecular previsto
18 kDa
SDS-PAGE
16.1 kDa, under reducing conditions; 16.1 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is recommended to reconstitute to a concentration of 0.1-1mg/mL.Dissolve the lyophilized protein in distilled water.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store it under sterile conditions at -20℃~ -80℃ for more than 1 year.It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles
Imágenes

Recombinant Mouse IL-1 beta Protein (rp154118)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-1 beta was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 16.1 kDa.

Recombinant Mouse IL-1 beta Protein (rp154118) - Protein Bioactivity
Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is typically 10 - 50 pg/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

7 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1214755Certificate of AnalysisJul 13, 2026 rp154118
ZJ24F1214756Certificate of AnalysisJul 13, 2026 rp154118
ZJ24F1214832Certificate of AnalysisJul 13, 2026 rp154118
ZJ23F0500160Certificate of AnalysisApr 07, 2026 rp154118
ZJ23F0500161Certificate of AnalysisApr 07, 2026 rp154118
ZJ23F0500163Certificate of AnalysisApr 07, 2026 rp154118
ZJ24F1214833Certificate of AnalysisOct 09, 2025 rp154118
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.