Recombinant Mouse IL-13 Protein, ≥95% (SDS-PAGE)

Cat. No.: rp154140
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P20109
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured in a cell proliferation assay using TF-1 Mouse erythroleukemic cells. The ED50 for this effect is 23.9-95.6 ng/mL, corresponding to a specific activity of 1.05×10^4-4.18×10^4 units/mg.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
1mg
rp154140-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
4.449,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity
≥95% (SDS-PAGE)
Endotoxin level
<0.1 EU/μg
Function
Cytokine (PubMed:8096327, PubMed:8097324). Inhibits inflammatory cytokine production (PubMed:8096327). Synergizes with IL2 in regulating interferon-gamma synthesis (PubMed:8096327). May be critical in regulating inflammatory and immune responses (PubMed:8096327, PubMed:8097324). Positively regulates IL31RA expression in macrophages.

Specifications

Product Name
Recombinant Mouse IL-13 Protein, ≥95% (SDS-PAGE)
Sinónimos
Allergic rhinitis | ALRH | BHR 1 | BHR1 | Bronchial hyperresponsiveness 1 (bronchial asthma) | IL 13 | IL-13 | Il13 | Interleukin 13 | Interleukin-13 | interleukin13 | MGC116786 | MGC116788 | MGC116789 | NC 30 | NC30 | P 600 | P600
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥95%(SDS-PAGE)
Pureza
≥95% (SDS-PAGE)
Bioactividad
Measured in a cell proliferation assay using TF-1 Mouse erythroleukemic cells. The ED50 for this effect is 23.9-95.6 ng/mL, corresponding to a specific activity of 1.05×10^4-4.18×10^4 units/mg.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
HEK293
Especie
Mouse
Aminoácidos
26-131 aa
Secuencia
SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
12.5 kDa
SDS-PAGE
15-30 kDa, under reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Mouse IL-13 Protein (rp154140) - Protein Bioactivity
Measured in a cell proliferation assay using TF-1 Mouse erythroleukemic cells. The ED50 for this effect is less than 10 ng/mL.

Recombinant Mouse IL-13 Protein (rp154140) - SDS-PAGE
2 μg/lane of Recombinant Mouse IL-13 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 15 kDa & 16 - 30 kDa due to glycosylation.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.