Recombinant Mouse IL-4 Protein, >95% (SDS-PAGE)

Cat. No.: rp154228
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P07750
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using assay using CTLL‑2 mouse cytotoxic T cells. The ED₅₀ for this effect is typically <1.8ng/mL.
Size
Estado
Price
Qty
10μg
rp154228-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
89,90US$
50μg
rp154228-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
239,90US$
1mg
rp154228-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.759,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

 

Specifications

Product Name
Recombinant Mouse IL-4 Protein, >95% (SDS-PAGE)
Sinónimos
B cell growth factor 1 | BCDF | B-cell stimulatory factor 1 | BCGF1 | BCGF-1 | binetrakin | BSF1 | BSF-1 | IL4 | IL-4 | IL-4B_cell stimulatory factor 1 | IL4E12 | interleukin 4 | interleukin-4 | Lymphocyte stimulatory factor 1 | MGC79402 | pitrakinra
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)
Mecanismos bioquímicos y fisiológicos
Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface express
Pureza
>95% (SDS-PAGE)
Bioactividad
Measured in a cell proliferation assay using assay using CTLL‑2 mouse cytotoxic T cells. The ED₅₀ for this effect is typically <1.8ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Especie
Mouse
Aminoácidos
21-140 aa
Secuencia
HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYSGGGGSHHHHHHHHHH
Etiqueta proteínica
C-His
Longitud de la proteína
Full length protein
Número de adhesión
Fuente
Recombinant
Peso molecular previsto
15.2 kDa
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in sterile H2O at not less than 100µg/ml, which can then be further diluted in other aqueous solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Mouse IL-4 Protein (rp154228)-Protein Bioactivity
Measured in a cell proliferation assay using assay using CTLL‑2 mouse cytotoxic T cells. The ED₅₀ for this effect is typically <1.8ng/mL.

Recombinant Mouse IL-4 Protein(rp154228)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-4 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.2 kDa.

Recombinant Mouse IL-4 Protein (rp154228) - Protein Bioactivity
Measured in a cell proliferation assay using assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is typically <1.8 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

14 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0636838Certificate of AnalysisJul 02, 2026 rp154228
ZJ26F0636839Certificate of AnalysisJul 02, 2026 rp154228
ZJ25F0521939Certificate of AnalysisMar 16, 2026 rp154228
ZJ25F0521940Certificate of AnalysisMar 16, 2026 rp154228
ZJ25F0521941Certificate of AnalysisMar 16, 2026 rp154228
ZJ24F0607418Certificate of AnalysisJun 28, 2024 rp154228
ZJ24F0607417Certificate of AnalysisJun 28, 2024 rp154228
ZJ24F0606576Certificate of AnalysisJun 07, 2024 rp154228
ZJ24F0606575Certificate of AnalysisJun 07, 2024 rp154228
ZJ24F0606574Certificate of AnalysisJun 07, 2024 rp154228
ZJ23F0901081Certificate of AnalysisSep 18, 2023 rp154228
ZJ23F0901080Certificate of AnalysisSep 18, 2023 rp154228
ZJ23F0400115Certificate of AnalysisApr 29, 2023 rp154228
ZJ23F0400114Certificate of AnalysisApr 29, 2023 rp154228

Show more ⌵

Preguntas frecuentes y artículos
Referencias
1. Huirong Huang, Shimin Zheng, Jianing Wu, Xindan Liang, Shengjie Li, Pengfei Mao, Zhinan He, Yahui Chen, Lining Sun, Xinyu Zhao, Aimin Cai, Luhui Wang, Huixiang Sheng, Qing Yao, Ruijie Chen, Ying-Zheng Zhao, Longfa Kou.  (2024)  Opsonization Inveigles Macrophages Engulfing Carrier-Free Bilirubin/JPH203 Nanoparticles to Suppress Inflammation for Osteoarthritis Therapy.  Advanced Science,      [PMID:38593402] [10.1002/advs.202400713]
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.