Recombinant Mouse Leptin Protein, CAS No.181030-10-4

CAS: 181030-10-4 Cat. No.: L329647
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Accession #
Q544U0
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Mouse LEPR (C-10His) at 5μg/ml (100 μl/well) can bind Recombinant Mouse Leptin Biotinylated by NHS-biotin prior to testing.The ED50 of Recombinant Mouse Leptin is 1.16 ng/ml. Loaded Recombinant Mouse LEPR (C-10His) on HIS1K Biosensor, can bind Recombinant Mouse Leptin with an affinity constant of 0.196 nM as determined in BLI assay.
Size
Estado
Price
Qty
1mg
L329647-1mg
1
599,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Mouse Leptin Protein, CAS No.181030-10-4
Sinónimos
FLJ94114 | LEP | leptin (murine obesity homolog) | leptin (obesity homolog, mouse) | Leptin | OB | Obese protein | obese, mouse, homolog of | Obesity factor | OBOBS | obese
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, PBS Only, ≥95%(SDS-PAGE)
Mecanismos bioquímicos y fisiológicos
May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic
Bioactividad
Immobilized Recombinant Mouse LEPR (C-10His) at 5μg/ml (100 μl/well) can bind Recombinant Mouse Leptin Biotinylated by NHS-biotin prior to testing.The ED50 of Recombinant Mouse Leptin is 1.16 ng/ml. Loaded Recombinant Mouse LEPR (C-10His) on HIS1K Biosensor, can bind Recombinant Mouse Leptin with an affinity constant of 0.196 nM as determined in BLI assay.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
22-167 aa
Secuencia
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
Número de adhesión
Peso molecular previsto
16.1 KDa
SDS-PAGE
14 KDa, under reducing conditions.
CAS
181030-10-4
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
Always centrifuge tubes before opening.Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ long term (12 months). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

combinant Mouse Leptin Protein (L329647) - Protein Bioactivity
Immobilized Recombinant Mouse LEPR Protein at 5 μg/mL can bind Recombinant Mouse Leptin Protein (L329647). The ED50 for this effect is 1.16 ng/mL.

Recombinant Mouse Leptin Protein (L329647) - SDS-PAGE
2 μg/lane of Recombinant Mouse Leptin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1113297Certificate of AnalysisMay 21, 2026 L329647
ZJ25F0623040Certificate of AnalysisApr 06, 2026 L329647
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.