Recombinant MPXV A30L Protein, >95% (SDS-PAGE)

Cat. No.: rp155933
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
Q8V4U9
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp155933-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
267,90US$
50μg
rp155933-50μg
1
799,90US$
100μg
rp155933-100μg
1
1.199,90US$
1mg
rp155933-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
5.199,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) Animal Free,Azide Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -80°C,Avoid repeated freezing and thawing Ships Dry ice packs + Cold packs Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Envelope protein required for virus entry into host cell and for cell-cell fusion (syncytium formation).
Description:
Monkeypox is a zoonotic disease caused by monkeypox virus (MPXV), which is a member of orthopoxvirus genus. A30L protein is required for the association of electron-dense, granular, proteinaceous material with the concave surfaces of crescent membranes, an early step in viral morphogenesis. The A30L protein is believed to be located in the matrix between the core and membrane. In vivo and in vitro experiments provided evidence for the direct interaction of the A30L and G7L proteins and demonstrated that the stability of each one was dependent on its association with the other. A presumption was that the A30L protein is a key element in the linkage between the viral core and the membrane. And some data indicate that protein-protein interactions are needed for the association of the dense viroplasm with IV membranes. Of the two interacting proteins identified, the G7L protein appears to be a component of the core whereas the A30L protein may be a component of the matrix between the core and membrane.

Specifications

Product Name
Recombinant MPXV A30L Protein, >95% (SDS-PAGE)
Sinónimos
Envelope protein OPG155 | Protein A30 | OPG155 | A30L | IMV surface protein A30L | Monkeypox virus A30L | Monkeypox virus
Grado
Animal Free, Azide Free, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)
Pureza
>95% (SDS-PAGE)
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Especie
Monkeypox virus
Aminoácidos
26-146 aa
Secuencia
MIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVLENLYFQGHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
15.5 kDa
SDS-PAGE
25-30 kDa, reducing conditions; 23-28 kDa, non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -80°C,Avoid repeated freezing and thawing
Enviado en
Dry ice packs + Cold packs
Estabilidad y almacenamiento
Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle.
Imágenes

Recombinant MPXV A30L Protein (rp155933) - SDS-PAGE
3 μg/lane of Recombinant MPVX A30L Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 25-30 kDa under reducing conditions and 23-28 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeFechaArticulo
ZJ23F0700579Certificate of AnalysisJul 14, 2023 rp155933
ZJ23F0700580Certificate of AnalysisJul 14, 2023 rp155933
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.