Recombinant MPXV E8L Protein, >95% (SDS-PAGE)

Cat. No.: rp155937
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
Q8V4Y0
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp155937-10μg
≥10
159,90US$
100μg
rp155937-100μg
4
799,90US$
1mg
rp155937-1mg
1
3.999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) Animal Free,Azide Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Desscription:
Monkeypox Virus (MPXV), the virus that causes monkeypox infection in both humans and animals, is a double-stranded DNA virus that had a recent global outbreak in 2022. MPXV belongs to the Poxviridae family of viruses. It consists of several key subunits including a surface membrane fusion protein (A29L, ~14 kDa), two separate envelope proteins (A30L ~14 kDa and H3L ~32kDa), an envelope glycoprotein, (A35R ~15 kDa), a receptor glycoprotein that mimics IFN‑alpha/beta (B16, ~37kDa), a palmitoylated EEV membrane glycoprotein (C19L, ~35 kDa), a secreted IL-18 binding protein (D6L, ~14kDa), a cell surface-binding protein (E8L, ~32 kDa), a telomere binding protein (I1L, ~36kDa), and a subunit required for DNA packaging (L1R, 18 kDa). The E8L subunit in MPXV is a surface binding protein that plays a key role in viral entry. This happens with E8L binding to chondroitin sulfate on the surface of cells, giving MPXV virion attachment to the host cell. In infected samples, E8L is identified in abundance with intracellular proteins. When targeting the E8L subunit, transmission and replication was reduced by 78% when treated with 100 nM of small interference RNA (siRNA) and reduced by 95% when treated with 200 nM of siRNA. The E8L subunit is the most promising target for a newer, more effective vaccine against MPXV, as it has been found to contain human-foreign pentapeptides that could contain epitopes that would be viable for MPXV vaccinations.

Specifications

Product Name
Recombinant MPXV E8L Protein, >95% (SDS-PAGE)
Sinónimos
Cell surface-binding protein OPG105 | Carbonic anhydrase homolog | E8L | IMV membrane protein E8L | Cell surface-binding protein OPG105 | Carbonic anhydrase homolog | E8L | IMV membrane protein E8L
Grado
Animal Free, Azide Free, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)
Pureza
>95% (SDS-PAGE)
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
1-275 aa
Secuencia
MPQQLSPINIETKKAISDTRLKTLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSTIHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGIIIIAIFLQVSDHKNVYFQKIVNQLDSIRSANMSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHEGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPVRENYFMKWLSDLREACFSYYQKYIEGNKTENLYFQGHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
35.8 kDa
SDS-PAGE
35-55 and 65-100 kDa, under reducing conditions; 35-55 and 65-100 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant MPXV E8L Protein (rp155937) - SDS-PAGE
2 μg/lane of Recombinant MPXV E8L Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 35-55 & 65-100 kDa under reducing conditions and 35-55 & 65-100 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0102683Certificate of AnalysisJun 18, 2026 rp155937
ZJ24F0102684Certificate of AnalysisJun 18, 2026 rp155937
ZJ24F0102685Certificate of AnalysisJun 18, 2026 rp155937
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.